• Gene id: 23516

Gene Summary

• Gene Symbol: SLC39A14   Gene   UCSC   Ensembl
• Aliases: HCIN, HMNDYT2, LZT-Hs4, NET34, ZIP14, cig19
• Gene name: solute carrier family 39 member 14
• Alternate names: metal cation symporter ZIP14, zinc transporter ZIP14, LIV-1 subfamily of ZIP zinc transporter 4, Zinc transporter ZIP14, Zrt-, Irt-like protein 14, solute carrier family 39 (metal ion transporter), member 14, solute carrier family 39 (zinc transporter), member ,
• Gene location: 8p21.3 (22367277: 22434128)     Exons: 16     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the the SLC39A family of divalent metal transporters that mediates the cellular uptake of manganese, zinc, iron, and cadmium. The encoded protein contains eight transmembrane domains, a histidine-rich motif, and a metalloprot
• OMIM: 609851

Protein Summary

• Protein general information: Q15043  
  • Name: Metal cation symporter ZIP14 (LIV 1 subfamily of ZIP zinc transporter 4) (LZT Hs4) (Solute carrier family 39 member 14) (Zrt and Irt like protein 14) (ZIP 14)
  • Length: 492  
  • Mass: 54212
  • Tissue specificity: Ubiquitously expressed, with higher expression in liver, pancreas, fetal liver, thyroid gland, left and right ventricle, right atrium and fetal heart (PubMed
• Sequence:

  MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGR
  GNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSA
  VEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPLEDYYVSKSA
  VVFGGFYLFFFTEKILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPM
  VDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILC
  EEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSANWIFALAGGMFLYISLADMFPEMNE
  VCQEDERKGSILIPFIIQNLGLLTGFTIMVVLTMYSGQIQIG

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000352779
• Other Databases: GeneCards:  SLC39A14  Malacards:  SLC39A14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0071578	zinc ion import across plasma membrane	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0071578	zinc ion import across plasma membrane	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0015296	anion:cation symporter activity	ISS	molecular function
GO:0015086	cadmium ion transmembrane transporter activity	ISS	molecular function
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0055071	manganese ion homeostasis	ISS	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0010817	regulation of hormone levels	ISS	biological process
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0006094	gluconeogenesis	ISS	biological process
GO:0098739	import across plasma membrane	IMP	biological process
GO:0071421	manganese ion transmembrane transport	IMP	biological process
GO:0033212	iron import into cell	IMP	biological process
GO:0071421	manganese ion transmembrane transport	IMP	biological process
GO:0005381	iron ion transmembrane transporter activity	ISS	molecular function
GO:0070574	cadmium ion transmembrane transport	ISS	biological process
GO:0051344	negative regulation of cyclic-nucleotide phosphodiesterase activity	ISS	biological process
GO:0045745	positive regulation of G protein-coupled receptor signaling pathway	ISS	biological process
GO:0002062	chondrocyte differentiation	ISS	biological process
GO:0005384	manganese ion transmembrane transporter activity	IMP	molecular function
GO:0034755	iron ion transmembrane transport	IMP	biological process
GO:0005384	manganese ion transmembrane transporter activity	IMP	molecular function
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0071577	zinc ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0055071	manganese ion homeostasis	IEA	biological process
GO:0033212	iron import into cell	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015296	anion:cation symporter activity	IEA	molecular function
GO:0015086	cadmium ion transmembrane transporter activity	IEA	molecular function
GO:0010817	regulation of hormone levels	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0006826	iron ion transport	IEA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0070574	cadmium ion transmembrane transport	IEA	biological process
GO:0051344	negative regulation of cyclic-nucleotide phosphodiesterase activity	IEA	biological process
GO:0045745	positive regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0034755	iron ion transmembrane transport	IEA	biological process
GO:0015093	ferrous iron transmembrane transporter activity	IEA	molecular function
GO:0006829	zinc ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005384	manganese ion transmembrane transporter activity	IEA	molecular function
GO:0005381	iron ion transmembrane transporter activity	IEA	molecular function
GO:0002062	chondrocyte differentiation	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0006882	cellular zinc ion homeostasis	IDA	biological process
GO:0006882	cellular zinc ion homeostasis	IDA	biological process
GO:0071577	zinc ion transmembrane transport	IDA	biological process
GO:0071578	zinc ion import across plasma membrane	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0015698	inorganic anion transport	IEA	biological process
GO:0015698	inorganic anion transport	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0071577	zinc ion transmembrane transport	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04216	Ferroptosis

Diseases

Associated diseases	References
Hypermanganesemia with dystonia	KEGG:H01938
Hypermanganesemia with dystonia	KEGG:H01938
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq