• Gene id: 23515

Gene Summary

• Gene Symbol: MORC3   Gene   UCSC   Ensembl
• Aliases: NXP2, ZCW5, ZCWCC3
• Gene name: MORC family CW-type zinc finger 3
• Alternate names: MORC family CW-type zinc finger protein 3, nuclear matrix protein 2, nuclear matrix protein NXP2, zinc finger CW-type coiled-coil domain protein 3, zinc finger, CW type with coiled-coil domain 3,
• Gene location: 21q22.12 (85647918: 85656552)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces mult
• OMIM: 610078

Protein Summary

• Protein general information: Q14149  
  • Name: MORC family CW type zinc finger protein 3 (Nuclear matrix protein 2) (Zinc finger CW type coiled coil domain protein 3)
  • Length: 939  
  • Mass: 107113
  • Tissue specificity: Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney. {ECO
• Sequence:

  MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSD
  KLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAF
  NKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDL
  DEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVYRPKFLSKTVR
  ITFGFNCRNKDHYGIMMYHRNRLIKAYEKVGCQLRANNMGVGVVGIIECNFLKPTHNKQDFDYTNEYRLTITALG
  EKLNDYWNEMKVKKNTEYPLNLPVEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPE
  EPEDEDLVHPTYEKTYKKTNKEKFRIRQPEMIPRINAELLFRPTALSTPSFSSPKESVPRRHLSEGTNSYATRLL
  NNHQVPPQSEPESNSLKRRLSTRSSILNAKNRRLSSQFENSVYKGDDDDEDVIILEENSTPKPAVDHDIDMKSEQ
  SHVEQGGVQVEFVGDSEPCGQTGSTSTSSSRCDQGNTAATQTEVPSLVVKKEETVEDEIDVRNDAVILPSCVEAE
  AKIHETQETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTET
  DAVFLLESINGKSESPDHMVSQYQQALEEIERLKKQCSALQHVKAECSQCSNNESKSEMDEMAVQLDDVFRQLDK
  CSIERDQYKSEVELLEMEKSQIRSQCEELKTEVEQLKSTNQQTATDVSTSSNIEESVNHMDGESLKLRSLRVNVG
  QLLAMIVPDLDLQQVNYDVDVVDEILGQVVEQMSEISST

• Structural information:
  • Interpro: IPR036890  IPR041006  IPR011124  
  • Prosite: PS51050
  • PDB: 4QQ4 5SVI 5SVX 5SVY 6O1E 6O5W
  • PDBsum: 4QQ4 5SVI 5SVX 5SVY 6O1E 6O5W
  • STRING: ENSP00000383333
• Other Databases: GeneCards:  MORC3  Malacards:  MORC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0051457	maintenance of protein location in nucleus	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0007569	cell aging	IDA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IDA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0051457	maintenance of protein location in nucleus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0009791	post-embryonic development	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881