• Gene id: 23513

Gene Summary

• Gene Symbol: SCRIB   Gene   UCSC   Ensembl
• Aliases: CRIB1, SCRB1, SCRIB1, Vartul
• Gene name: scribble planar cell polarity protein
• Alternate names: protein scribble homolog, scribbled homolog, scribbled planar cell polarity protein,
• Gene location: 8q24.3 (143815772: 143790924)     Exons: 37     NC_000008.11
• Gene summary(Entrez): This gene encodes a protein that was identified as being similar to the Drosophila scribble protein. The mammalian protein is involved in tumor suppression pathways. As a scaffold protein involved in cell polarization processes, this protein binds to many
• OMIM: 607733

Protein Summary

• Protein general information: Q14160  
  • Name: Protein scribble homolog (Scribble) (hScrib) (Protein LAP4)
  • Length: 1630  
  • Mass: 174885
  • Tissue specificity: Expressed in kidney, skeletal muscles, liver, lung, breast, intestine, placenta and skin mainly in epithelial cells (at protein level). {ECO
• Sequence:

  MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNEIQRLP
  PEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNL
  ANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCL
  DVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
  LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPF
  ALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQPPPSLEDAGQQGSLSETWSDAPPSRVSVIQF
  LEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSR
  PSASTVSEAEPEGPSAEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
  RLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKEEEEEEEGSPQEEEVE
  EEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTP
  YKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTI
  TPLRPEDDYSPRERRGGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEG
  GAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLPHSSPPTAAVATTSIT
  TATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARS
  GLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGN
  PRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAAL
  EVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRGLQPLKLDYRALAAVP
  SAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQAYRAFAAVPTSHPPEDAPAQPPTPGPAASPE
  QLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGE
  EEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRAL
  WRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRS
  LEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRPGRRGLGPVPS

• Structural information:
  • Protein Domains: (728..81-)
    (/note="PDZ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (862..95-)
    (/note="PDZ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (1004..109-)
    (/note="PDZ-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (-)
  • Interpro: IPR001611  IPR003591  IPR032675  IPR001478  IPR036034  
  • Prosite: PS51450 PS50106
  • PDB: 1UJU 1WHA 1X5Q 2W4F 4WYT 4WYU 5VWC 5VWI 5VWK 6EEY 6ESP 6MS1 6MTU 6MTV 6MYE 6MYF
  • PDBsum: 1UJU 1WHA 1X5Q 2W4F 4WYT 4WYU 5VWC 5VWI 5VWK 6EEY 6ESP 6MS1 6MTU 6MTV 6MYE 6MYF
  • DIP: 31259
  • STRING: ENSP00000349486
• Other Databases: GeneCards:  SCRIB  Malacards:  SCRIB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome	IBA	biological process
GO:0098609	cell-cell adhesion	IBA	biological process
GO:0097120	receptor localization to synapse	IBA	biological process
GO:0030054	cell junction	IBA	cellular component
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0008328	ionotropic glutamate receptor complex	IBA	colocalizes with
GO:0005912	adherens junction	IBA	cellular component
GO:0005911	cell-cell junction	IBA	cellular component
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IBA	biological process
GO:0097060	synaptic membrane	IBA	colocalizes with
GO:0045211	postsynaptic membrane	IBA	colocalizes with
GO:0045202	synapse	IBA	cellular component
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IBA	biological process
GO:0043113	receptor clustering	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:0042734	presynaptic membrane	IDA	colocalizes with
GO:0005912	adherens junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0045930	negative regulation of mitotic cell cycle	IDA	biological process
GO:0045211	postsynaptic membrane	IDA	colocalizes with
GO:0031252	cell leading edge	IDA	colocalizes with
GO:0008283	cell population proliferation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0060561	apoptotic process involved in morphogenesis	IMP	biological process
GO:0090630	activation of GTPase activity	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0098609	cell-cell adhesion	IGI	biological process
GO:0030859	polarized epithelial cell differentiation	IMP	biological process
GO:0060603	mammary gland duct morphogenesis	ISS	biological process
GO:0050918	positive chemotaxis	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0035089	establishment of apical/basal cell polarity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001921	positive regulation of receptor recycling	IMP	biological process
GO:0001843	neural tube closure	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0030683	mitigation of host immune response by virus	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0039563	suppression by virus of host STAT1 activity	IEA	biological process
GO:0039564	suppression by virus of host STAT2 activity	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001768	establishment of T cell polarity	IEA	biological process
GO:0001772	immunological synapse	IEA	cellular component
GO:0016080	synaptic vesicle targeting	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016331	morphogenesis of embryonic epithelium	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0035748	myelin sheath abaxonal region	IEA	cellular component
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0046007	negative regulation of activated T cell proliferation	IEA	biological process
GO:0060088	auditory receptor cell stereocilium organization	IEA	biological process
GO:0060122	inner ear receptor cell stereocilium organization	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0043615	astrocyte cell migration	IEA	biological process
GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0002093	auditory receptor cell morphogenesis	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0021747	cochlear nucleus development	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0044291	cell-cell contact zone	IEA	cellular component
GO:0048488	synaptic vesicle endocytosis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0060603	mammary gland duct morphogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA	biological process
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:0099147	extrinsic component of postsynaptic density membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0034750	Scrib-APC-beta-catenin complex	IDA	cellular component
GO:0071896	protein localization to adherens junction	IMP	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046007	negative regulation of activated T cell proliferation	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0001772	immunological synapse	ISS	cellular component
GO:0001768	establishment of T cell polarity	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa05203	Viral carcinogenesis
hsa04530	Tight junction
hsa04390	Hippo signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq