• Gene id: 23480

Gene Summary

• Gene Symbol: SEC61G   Gene   UCSC   Ensembl
• Aliases: SSS1
• Gene name: SEC61 translocon subunit gamma
• Alternate names: protein transport protein Sec61 subunit gamma, SEC61 translocon gamma subunit, Sec61 gamma subunit, protein transport protein SEC61 gamma subunit,
• Gene location: 7p11.2 (54759245: 54752246)     Exons: 4     NC_000007.14
• Gene summary(Entrez): The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER mem
• OMIM: 609215

Protein Summary

• Protein general information: P60059  
  • Name: Protein transport protein Sec61 subunit gamma
  • Length: 68  
  • Mass: 7741
• Sequence:

  MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

• Structural information:
  • Interpro: IPR023391  IPR008158  IPR001901  
  • Prosite: PS01067
  • STRING: ENSP00000388337
• Other Databases: GeneCards:  SEC61G  Malacards:  SEC61G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031204	posttranslational protein targeting to membrane, translocation	IBA	biological process
GO:0071261	Ssh1 translocon complex	IBA	cellular component
GO:0008320	protein transmembrane transporter activity	IBA	molecular function
GO:0006605	protein targeting	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0015450	P-P-bond-hydrolysis-driven protein transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0008320	protein transmembrane transporter activity	ISS	molecular function
GO:0045047	protein targeting to ER	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa04145	Phagosome
hsa05110	Vibrio cholerae infection
hsa03060	Protein export

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)