• Gene id: 2348

Gene Summary

• Gene Symbol: FOLR1   Gene   UCSC   Ensembl
• Aliases: FBP, FOLR, FRalpha
• Gene name: folate receptor alpha
• Alternate names: folate receptor alpha, FR-alpha, KB cells FBP, adult folate-binding protein, folate binding protein, folate receptor 1 (adult), folate receptor, adult, ovarian tumor-associated antigen MOv18,
• Gene location: 11q13.4 (72189708: 72196322)     Exons: 7     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anc
• OMIM: 602001

Protein Summary

• Protein general information: P15328  
  • Name: Folate receptor alpha (FR alpha) (Adult folate binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor associated antigen MOv18)
  • Length: 257  
  • Mass: 29819
  • Tissue specificity: Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium. {ECO
• Sequence:

  MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAH
  KDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSY
  TCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEV
  ARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS

• Structural information:
  • Interpro: IPR004269  IPR018143  IPR032935  
  • PDB: 4KM6 4KM7 4KMX 4LRH 5IZQ
  • PDBsum: 4KM6 4KM7 4KMX 4LRH 5IZQ
  • STRING: ENSP00000377284
• Other Databases: GeneCards:  FOLR1  Malacards:  FOLR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0031362	anchored component of external side of plasma membrane	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0005542	folic acid binding	IDA	molecular function
GO:0005542	folic acid binding	IDA	molecular function
GO:0061714	folic acid receptor activity	IMP	molecular function
GO:0015884	folic acid transport	IMP	biological process
GO:0016020	membrane	TAS	cellular component
GO:0061714	folic acid receptor activity	IEA	molecular function
GO:0005542	folic acid binding	IEA	molecular function
GO:1904447	folate import across plasma membrane	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005542	folic acid binding	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005542	folic acid binding	TAS	molecular function
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0015884	folic acid transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061626	pharyngeal arch artery morphogenesis	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0046655	folic acid metabolic process	IEA	biological process
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0001947	heart looping	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0061713	anterior neural tube closure	IEA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0031103	axon regeneration	IEA	biological process
GO:0003253	cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA	biological process
GO:0003147	neural crest cell migration involved in heart formation	IEA	biological process
GO:0031526	brush border membrane	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005542	folic acid binding	IEA	molecular function
GO:0061714	folic acid receptor activity	IC	molecular function
GO:0051870	methotrexate binding	IDA	molecular function
GO:0005542	folic acid binding	IDA	molecular function
GO:0071231	cellular response to folic acid	IDA	biological process
GO:0061713	anterior neural tube closure	ISS	biological process
GO:0005542	folic acid binding	IDA	molecular function
GO:0008144	drug binding	IPI	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0001947	heart looping	ISS	biological process
GO:0061626	pharyngeal arch artery morphogenesis	ISS	biological process
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0003253	cardiac neural crest cell migration involved in outflow tract morphogenesis	ISS	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0003147	neural crest cell migration involved in heart formation	ISS	biological process
GO:0031103	axon regeneration	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005542	folic acid binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Neurodegeneration due to cerebral folate transport deficiency	KEGG:H01295
Neurodegeneration due to cerebral folate transport deficiency	KEGG:H01295
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R