• Gene id: 23478

Gene Summary

• Gene Symbol: SEC11A   Gene   UCSC   Ensembl
• Aliases: 1810012E07Rik, SEC11L1, SPC18, SPCS4A, sid2895
• Gene name: SEC11 homolog A, signal peptidase complex subunit
• Alternate names: signal peptidase complex catalytic subunit SEC11A, SEC11-like protein 1, SPase 18 kDa subunit, endopeptidase SP18, microsomal signal peptidase 18 kDa subunit, signal peptidase complex (18kD), signal peptidase complex 18,
• Gene location: 15q25.2-q25.3 (84716459: 84669536)     Exons: 9     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in
• OMIM: 618258

Protein Summary

• Protein general information: P67812  
  • Name: Signal peptidase complex catalytic subunit SEC11A (EC 3.4.21.89) (Endopeptidase SP18) (Microsomal signal peptidase 18 kDa subunit) (SPase 18 kDa subunit) (SEC11 homolog A) (SEC11 like protein 1) (SPC18)
  • Length: 179  
  • Mass: 20625
• Sequence:

  MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVED
  PIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIG
  IVTILMNDYPKFKYAVLFLLGLFVLVHRE

• Structural information:
  • Interpro: IPR036286  IPR019758  IPR019756  IPR015927  IPR001733   IPR037712  
  • Prosite: PS00501 PS00761
  • DIP: 50359
  • STRING: ENSP00000452697
• Other Databases: GeneCards:  SEC11A  Malacards:  SEC11A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008233	peptidase activity	IBA	molecular function
GO:0006465	signal peptide processing	IBA	biological process
GO:0005787	signal peptidase complex	IBA	cellular component
GO:0005787	signal peptidase complex	IEA	cellular component
GO:0006465	signal peptide processing	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray