• Gene id: 23471

Gene Summary

• Gene Symbol: TRAM1   Gene   UCSC   Ensembl
• Aliases: PNAS8, TRAM, TRAMP
• Gene name: translocation associated membrane protein 1
• Alternate names: translocating chain-associated membrane protein 1, translocating chain-associating membrane protein, translocation-associating membrane protein 1,
• Gene location: 8q13.3 (70608452: 70573217)     Exons: 12     NC_000008.11
• Gene summary(Entrez): This gene encodes a multi-pass membrane protein that is part of the mammalian endoplasmic reticulum. The encoded protein influences glycosylation and facilitates the translocation of secretory proteins across the endoplasmic reticulum membrane by regulati
• OMIM: 605190

Protein Summary

• Protein general information: Q15629  
  • Name: Translocating chain associated membrane protein 1
  • Length: 374  
  • Mass: 43072
• Sequence:

  MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESVSLYYY
  GIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPT
  ILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVL
  HYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV
  LASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS

• Structural information:
  • Protein Domains: (117..32-)
    (/note="TLC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00205"-)
  • Interpro: IPR006634  IPR013599  IPR016447  
  • Prosite: PS50922
  • DIP: 45978
  • STRING: ENSP00000262213
• Other Databases: GeneCards:  TRAM1  Malacards:  TRAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005791	rough endoplasmic reticulum	IBA	cellular component
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881