About Us

Search Result


Gene id 23468
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol CBX5   Gene   UCSC   Ensembl
Aliases HEL25, HP1, HP1A
Gene name chromobox 5
Alternate names chromobox protein homolog 5, HP1 alpha homolog, HP1-ALPHA, HP1Hs alpha, antigen p25, chromobox homolog 5 (HP1 alpha homolog, Drosophila), epididymis luminal protein 25, heterochromatin protein 1 homolog alpha, heterochromatin protein 1-alpha,
Gene location 12q13.13 (54280121: 54230941)     Exons: 6     NC_000012.12
Gene summary(Entrez) This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bi

Protein Summary

Protein general information P45973  

Name: Chromobox protein homolog 5 (Antigen p25) (Heterochromatin protein 1 homolog alpha) (HP1 alpha)

Length: 191  Mass: 22225

Sequence MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKE
GENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL
VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Structural information
Protein Domains
(20..7-)
(/note="Chromo-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00053-)
(121..17-)
(/note="Chromo-)
(subtype-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00053"-)
Interpro:  IPR016197  IPR000953  IPR017984  IPR023780  IPR008251  
IPR023779  
Prosite:   PS00598 PS50013

PDB:  
3FDT 3I3C
PDBsum:   3FDT 3I3C

DIP:  

5986

MINT:  
STRING:   ENSP00000209875
Other Databases GeneCards:  CBX5  Malacards:  CBX5

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0035064 methylated histone bindin
g
IDA molecular function
GO:0035064 methylated histone bindin
g
IDA molecular function
GO:0005634 nucleus
IDA cellular component
GO:0032991 protein-containing comple
x
IDA cellular component
GO:1990904 ribonucleoprotein complex
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0044877 protein-containing comple
x binding
IDA molecular function
GO:0043021 ribonucleoprotein complex
binding
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0000775 chromosome, centromeric r
egion
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0016032 viral process
IEA biological process
GO:0005635 nuclear envelope
TAS cellular component
GO:0005720 nuclear heterochromatin
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0007596 blood coagulation
TAS biological process
GO:0070317 negative regulation of G0
to G1 transition
TAS biological process
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003682 chromatin binding
IEA molecular function
GO:0005720 nuclear heterochromatin
IEA cellular component
GO:0005721 pericentric heterochromat
in
IEA cellular component
GO:0005730 nucleolus
IEA cellular component
GO:0010369 chromocenter
IEA cellular component
GO:0035064 methylated histone bindin
g
IEA molecular function
GO:0035097 histone methyltransferase
complex
IEA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IEA biological process
GO:0000118 histone deacetylase compl
ex
IEA cellular component
GO:0000776 kinetochore
IEA cellular component
GO:0000792 heterochromatin
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0017053 transcription repressor c
omplex
IEA cellular component
GO:0030674 protein-macromolecule ada
ptor activity
IEA molecular function
GO:0042802 identical protein binding
IEA molecular function
GO:0042826 histone deacetylase bindi
ng
IEA molecular function
GO:0070491 repressing transcription
factor binding
IEA molecular function
GO:0000784 nuclear chromosome, telom
eric region
IEA cellular component
GO:0005721 pericentric heterochromat
in
ISS cellular component
GO:0000784 nuclear chromosome, telom
eric region
HDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0030674 protein-macromolecule ada
ptor activity
ISS molecular function
GO:0070491 repressing transcription
factor binding
ISS molecular function
GO:0005730 nucleolus
IDA cellular component
GO:0000118 histone deacetylase compl
ex
ISS cellular component
GO:0035097 histone methyltransferase
complex
ISS cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IMP biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IMP biological process
GO:0005634 nucleus
IDA cellular component
GO:0016605 PML body
IMP colocalizes with
GO:0017053 transcription repressor c
omplex
ISS cellular component
GO:0031618 nuclear pericentric heter
ochromatin
NAS cellular component
GO:0000775 chromosome, centromeric r
egion
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IDA biological process
GO:0005515 protein binding
IPI molecular function
GO:0090734 site of DNA damage
IMP cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0006974 cellular response to DNA
damage stimulus
IMP biological process
GO:0005515 protein binding
IPI molecular function
Associated diseases References
Prostate cancer PMID:18436254
lung adenocarcinoma PMID:22900142
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract