• Gene id: 2346

Gene Summary

• Gene Symbol: FOLH1   Gene   UCSC   Ensembl
• Aliases: FGCP, FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA, mGCP
• Gene name: folate hydrolase 1
• Alternate names: glutamate carboxypeptidase 2, N-acetylated alpha-linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALADase I, cell growth-inhibiting gene 27 protein, folylpoly-gamma-glutamate carboxypeptidase, glutamate carboxylase II, glutamate car,
• Gene location: 11p11.12 (49208641: 49145091)     Exons: 21     NC_000011.10
• Gene summary(Entrez): This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-gl
• OMIM: 600934

Protein Summary

• Protein general information: Q04609  
  • Name: Glutamate carboxypeptidase 2 (EC 3.4.17.21) (Cell growth inhibiting gene 27 protein) (Folate hydrolase 1) (Folylpoly gamma glutamate carboxypeptidase) (FGCP) (Glutamate carboxypeptidase II) (GCPII) (Membrane glutamate carboxypeptidase) (mGCP) (N acetylate
  • Length: 750  
  • Mass: 84331
  • Tissue specificity: Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small i
• Sequence:

  MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLY
  NFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPG
  YENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGV
  ILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
  DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILG
  GHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYI
  NADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFF
  QRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY
  AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAF
  IDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

• Structural information:
  • Interpro: IPR003137  IPR007484  IPR039373  IPR007365  IPR036757  
  • PDB: 1Z8L 2C6C 2C6G 2C6P 2CIJ 2JBJ 2JBK 2OOT 2OR4 2PVV 2PVW 2XEF 2XEG 2XEI 2XEJ 3BHX 3BI0 3BI1 3BXM 3D7D 3D7F 3D7G 3D7H 3IWW 3RBU 3SJE 3SJF 3SJG 3SJX 4JYW 4JZ0 4LQG 4MCP 4MCQ 4MCR 4MCS 4NGM 4NGN 4NGP 4NGQ 4NGR 4NGS 4NGT 4OC0 4OC1 4OC2 4OC3 4OC4 4OC5 4OME 4P44 4P45 4P4B 4P4D 4P4E 4P4F 4P4I 4P4J 4W9Y 4X3R 5D29 5ELY 5F09 5O5
  • PDBsum: 1Z8L 2C6C 2C6G 2C6P 2CIJ 2JBJ 2JBK 2OOT 2OR4 2PVV 2PVW 2XEF 2XEG 2XEI 2XEJ 3BHX 3BI0 3BI1 3BXM 3D7D 3D7F 3D7G 3D7H 3IWW 3RBU 3SJE 3SJF 3SJG 3SJX 4JYW 4JZ0 4LQG 4MCP 4MCQ 4MCR 4MCS 4NGM 4NGN 4NGP 4NGQ 4NGR 4NGS 4NGT 4OC0 4OC1 4OC2 4OC3 4OC4 4OC5 4OME 4P44 4P45 4P4B 4P4D 4P4E 4P4F 4P4I 4P4J 4W9Y 4X3R 5D29 5ELY 5F09 5O5
  • STRING: ENSP00000256999
• Other Databases: GeneCards:  FOLH1  Malacards:  FOLH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004180	carboxypeptidase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006760	folic acid-containing compound metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IDA	molecular function
GO:0004181	metallocarboxypeptidase activity	IDA	molecular function
GO:1904493	tetrahydrofolyl-poly(glutamate) polymer binding	IDA	molecular function
GO:1904492	Ac-Asp-Glu binding	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0035609	C-terminal protein deglutamylation	IDA	biological process
GO:0035609	C-terminal protein deglutamylation	IDA	biological process
GO:0035609	C-terminal protein deglutamylation	IDA	biological process
GO:0004181	metallocarboxypeptidase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008233	peptidase activity	NAS	molecular function
GO:0006508	proteolysis	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00250	Alanine, aspartate and glutamate metabolism
hsa04977	Vitamin digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881