• Gene id: 23436

Gene Summary

• Gene Symbol: CELA3B   Gene   UCSC   Ensembl
• Aliases: CBPP, ELA3B
• Gene name: chymotrypsin like elastase 3B
• Alternate names: chymotrypsin-like elastase family member 3B, cholesterol-binding pancreatic protease, chymotrypsin like elastase family member 3B, elastase 3B, pancreatic, elastase IIIB, elastase-3B, fecal elastase 1, pancreatic elastase 1, pancreatic endopeptidase E, protease E, ,
• Gene location: 1p36.12 (21977021: 21989353)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3B has li
• OMIM: 618694

Protein Summary

• Protein general information: P08861  
  • Name: Chymotrypsin like elastase family member 3B (EC 3.4.21.70) (Elastase IIIB) (Elastase 3B) (Protease E)
  • Length: 270  
  • Mass: 29263
  • Tissue specificity: Pancreas. Not detectable in keratinocytes. {ECO
• Sequence:

  MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCI
  SSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDI
  LPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPT
  EDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

• Structural information:
  • Protein Domains: (29..26-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000338369
• Other Databases: GeneCards:  CELA3B  Malacards:  CELA3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0008233	peptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq