• Gene id: 23433

Gene Summary

• Gene Symbol: RHOQ   Gene   UCSC   Ensembl
• Aliases: ARHQ, HEL-S-42, RASL7A, TC10, TC10A
• Gene name: ras homolog family member Q
• Alternate names: rho-related GTP-binding protein RhoQ, RAS-like, family 7, member A, epididymis secretory protein Li 42, ras homolog gene family, member Q, ras-like protein TC10, ras-like protein family member 7A,
• Gene location: 2p21 (46542408: 46584687)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskel
• OMIM: 605857

Protein Summary

• Protein general information: P17081  
  • Name: Rho related GTP binding protein RhoQ (Ras like protein TC10) (Ras like protein family member 7A)
  • Length: 205  
  • Mass: 22659
• Sequence:

  MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRP
  LSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQK
  LAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • PDB: 2ATX
  • PDBsum: 2ATX
  • STRING: ENSP00000238738
• Other Databases: GeneCards:  RHOQ  Malacards:  RHOQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0042995	cell projection	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030866	cortical actin cytoskeleton organization	IBA	biological process
GO:0030865	cortical cytoskeleton organization	IBA	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0007015	actin filament organization	IBA	biological process
GO:0005938	cell cortex	IBA	cellular component
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008360	regulation of cell shape	IEA	biological process
GO:0030866	cortical actin cytoskeleton organization	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:1903077	negative regulation of protein localization to plasma membrane	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0032427	GBD domain binding	IPI	molecular function
GO:0005522	profilin binding	IPI	molecular function
GO:0051491	positive regulation of filopodium assembly	IDA	biological process
GO:0008286	insulin receptor signaling pathway	IMP	biological process
GO:0030866	cortical actin cytoskeleton organization	IMP	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:1903077	negative regulation of protein localization to plasma membrane	IMP	biological process
GO:0005884	actin filament	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0046039	GTP metabolic process	IDA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IC	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0046326	positive regulation of glucose import	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881