• Gene id: 23432

Gene Summary

• Gene Symbol: GPR161   Gene   UCSC   Ensembl
• Aliases: RE2
• Gene name: G protein-coupled receptor 161
• Alternate names: G-protein coupled receptor 161, G-protein coupled receptor RE2,
• Gene location: 1q24.2 (168137666: 168079541)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is an orphan G protein-coupled receptor whose ligand is unknown. This gene is overexpressed in triple-negative breast cancer, and disruption of this gene slows the proliferation of basal breast cancer cells. Therefore, thi
• OMIM: 300214

Protein Summary

• Protein general information: Q8N6U8  
  • Name: G protein coupled receptor 161 (G protein coupled receptor RE2)
  • Length: 529  
  • Mass: 58559
• Sequence:

  MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLTLSNKFVFSLTLSNFL
  LSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGVIAIDRYYAVLYPMVYPMKITGNRAVMALVY
  IWLHSLIGCLPPLFGWSSVEFDEFKWMCVAAWHREPGYTAFWQIWCALFPFLVMLVCYGFIFRVARVKARKVHCG
  TVVIVEEDAQRTGRKNSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFMVTWGPYMVVIASEALWGKSS
  VSPSLETWATWLSFASAVCHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLT
  ALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILH
  VKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA
  AEQR

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000441039
• Other Databases: GeneCards:  GPR161  Malacards:  GPR161

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055037	recycling endosome	ISS	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:1901621	negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0004930	G protein-coupled receptor activity	ISS	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0060170	ciliary membrane	TAS	cellular component
GO:0060170	ciliary membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:1901621	negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0060170	ciliary membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04340	Hedgehog signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881