• Gene id: 23426

Gene Summary

• Gene Symbol: GRIP1   Gene   UCSC   Ensembl
• Aliases: FRASRS3, GRIP
• Gene name: glutamate receptor interacting protein 1
• Alternate names: glutamate receptor-interacting protein 1,
• Gene location: 12q14.3 (67069264: 66347430)     Exons: 28     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the glutamate receptor interacting protein family. The encoded scaffold protein binds to and mediates the trafficking and membrane organization of a number of transmembrane proteins. Alternatively spliced transcript variants
• OMIM: 604597

Protein Summary

• Protein general information: Q9Y3R0  
  • Name: Glutamate receptor interacting protein 1 (GRIP 1)
  • Length: 1128  
  • Mass: 122422
• Sequence:

  MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKD
  GKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRT
  VEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQ
  CGQEAALLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDH
  ILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGPDHVKIQRSDRQLTWDSWASNHSSLHTNHHY
  NTYHPDHCRVPALTFPKAPPPNSPPALVSSSFSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKS
  SLSLASSTVGLAGQVVHTETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVM
  AINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGITISSPSSRKPGDPL
  VISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVE
  LKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK
  IKKQTDAQSASSPKKFPISSHLSDLGDVEEDSSPAQKPGKLSDMYPSTVPSVDSAVDSWDGSAIDTSYGTQGTSF
  QASGYNFNTYDWRSPKQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTASGFAGAADSAETEQEENFWSQALEDLET
  CGQSGILRELEEKADRRVSLRNMTLLATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPS
  DVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDR
  LLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKSIDQQSLPGDWSEQNSAFFQQPSHGGNLETREPT
  NTL

• Structural information:
  • Protein Domains: (53..13-)
    (/note="PDZ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (150..23-)
    (/note="PDZ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (252..33-)
    (/note="PDZ-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (-)
  • Interpro: IPR030026  IPR001478  IPR041489  IPR036034  
  • Prosite: PS50106
  • PDB: 2JIL
  • PDBsum: 2JIL
  • STRING: ENSP00000381098
• Other Databases: GeneCards:  GRIP1  Malacards:  GRIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150012	positive regulation of neuron projection arborization	ISS	biological process
GO:0035259	glucocorticoid receptor binding	IBA	molecular function
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0016358	dendrite development	IEA	biological process
GO:0030159	signaling receptor complex adaptor activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008013	beta-catenin binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0030159	signaling receptor complex adaptor activity	NAS	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function

Diseases

Associated diseases	References
Fraser syndrome	KEGG:H00687
Fraser syndrome	KEGG:H00687
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)