• Gene id: 23417

Gene Summary

• Gene Symbol: MLYCD   Gene   UCSC   Ensembl
• Aliases: MCD
• Gene name: malonyl-CoA decarboxylase
• Alternate names: malonyl-CoA decarboxylase, mitochondrial, malonyl coenzyme A decarboxylase,
• Gene location: 16q23.3 (83899114: 83927030)     Exons: 5     NC_000016.10
• Gene summary(Entrez): The product of this gene catalyzes the breakdown of malonyl-CoA to acetyl-CoA and carbon dioxide. Malonyl-CoA is an intermediate in fatty acid biosynthesis, and also inhibits the transport of fatty acyl CoAs into mitochondria. Consequently, the encoded pr
• OMIM: 606761

Protein Summary

• Protein general information: O95822  
  • Name: Malonyl CoA decarboxylase, mitochondrial (MCD) (EC 4.1.1.9)
  • Length: 493  
  • Mass: 55003
  • Tissue specificity: Expressed in fibroblasts and hepatoblastoma cells (at protein level). Expressed strongly in heart, liver, skeletal muscle, kidney and pancreas. Expressed in myotubes. Expressed weakly in brain, placenta, spleen, thymus, testis, ovary a
• Sequence:

  MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFY
  GGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGG
  VRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWM
  DMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
  VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSECKEISEITGGPINETL
  KLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGL
  MANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL

• Structural information:
  • Interpro: IPR038917  IPR007956  IPR042303  IPR035372  IPR038351  
  • PDB: 2YGW 4F0X
  • PDBsum: 2YGW 4F0X
  • DIP: 60405
  • STRING: ENSP00000262430
• Other Databases: GeneCards:  MLYCD  Malacards:  MLYCD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001294	malonyl-CoA catabolic process	IBA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IBA	molecular function
GO:0046321	positive regulation of fatty acid oxidation	IBA	biological process
GO:0006085	acetyl-CoA biosynthetic process	IBA	biological process
GO:0005782	peroxisomal matrix	IBA	cellular component
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:2001294	malonyl-CoA catabolic process	IDA	biological process
GO:2001294	malonyl-CoA catabolic process	IDA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IDA	molecular function
GO:0006085	acetyl-CoA biosynthetic process	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0002931	response to ischemia	ISS	biological process
GO:0005782	peroxisomal matrix	ISS	cellular component
GO:0005759	mitochondrial matrix	ISS	cellular component
GO:0005759	mitochondrial matrix	ISS	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0016831	carboxy-lyase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0050080	malonyl-CoA decarboxylase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0050080	malonyl-CoA decarboxylase activity	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0046321	positive regulation of fatty acid oxidation	IEA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IEA	molecular function
GO:2001294	malonyl-CoA catabolic process	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005782	peroxisomal matrix	IEA	cellular component
GO:0006085	acetyl-CoA biosynthetic process	IEA	biological process
GO:0010906	regulation of glucose metabolic process	IEA	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0031998	regulation of fatty acid beta-oxidation	IEA	biological process
GO:0046320	regulation of fatty acid oxidation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005782	peroxisomal matrix	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0006085	acetyl-CoA biosynthetic process	IEA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IDA	molecular function
GO:0050080	malonyl-CoA decarboxylase activity	IDA	molecular function
GO:0006633	fatty acid biosynthetic process	IDA	biological process
GO:0006085	acetyl-CoA biosynthetic process	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:2001294	malonyl-CoA catabolic process	IDA	biological process
GO:0050080	malonyl-CoA decarboxylase activity	IDA	molecular function
GO:0006085	acetyl-CoA biosynthetic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0046321	positive regulation of fatty acid oxidation	IMP	biological process
GO:0010906	regulation of glucose metabolic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04152	AMPK signaling pathway
hsa04146	Peroxisome
hsa00410	beta-Alanine metabolism
hsa00640	Propanoate metabolism

Diseases

Associated diseases	References
Malonyl-CoA decarboxylase deficiency	KEGG:H01283
Malonyl-CoA decarboxylase deficiency	KEGG:H01283
Cardiomyopathy	PMID:10455107
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq