• Gene id: 23414

Gene Summary

• Gene Symbol: ZFPM2   Gene   UCSC   Ensembl
• Aliases: DIH3, FOG2, SRXY9, ZC2HC11B, ZNF89B, hFOG-2
• Gene name: zinc finger protein, FOG family member 2
• Alternate names: zinc finger protein ZFPM2, FOG-2, Friend of GATA2, friend of GATA 2, friend of GATA protein 2, transcription factor GATA4, modulator of, zinc finger protein 89B, zinc finger protein, multitype 2,
• Gene location: 8q23.1 (105318437: 105804538)     Exons: 10     NC_000008.11
• Gene summary(Entrez): The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in ma
• OMIM: 603693

Protein Summary

• Protein general information: Q8WW38  
  • Name: Zinc finger protein ZFPM2 (Friend of GATA protein 2) (FOG 2) (Friend of GATA 2) (hFOG 2) (Zinc finger protein 89B) (Zinc finger protein multitype 2)
  • Length: 1151  
  • Mass: 128159
  • Tissue specificity: Widely expressed at low level. {ECO
• Sequence:

  MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDEGIQET
  AESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLPVGTTWGPFPGKMDLNNNSLKTKAQVPMVL
  TAGPKWLLDVTWQGVEDNKNNCIVYSKGGQLWCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLD
  SIQLLPQQAAMASILPTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEENEDSAHQISSLCPF
  PQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQAAFRCNHCHFGFQTQ
  RELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSELPQSQKAMQTKDASSDTELDKCEKKTQLFLT
  NQRPEIQPTTNKQSFSYTKIKSEPSSPRLASSPVQPNIGPSFPVGPFLSQFSFPQDITMVPQASEILAKMSELVH
  RRLRHGSSSYPPVIYSPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTG
  QTSINLLNPAAHSADPENPLLQTSCINSSTVLDLIGPNGKGHDKDFSTQTKKLSTSSNNDDKINGKPVDVKNPSV
  PLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKRSASNKVPAMQRTMRTRKRRKMYEMCLPEQE
  QRPPLVQQRFLDVANLNNPCTSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLE
  MDVPIDLSKKCLSQSERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPES
  ERNSPDVSYERSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRHLFLPQCLYPGAIKKA
  KGADQLSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQ
  DERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCD
  IQFNNLSNFITHKKFYCSSHAAEHVK

• Structural information:
  • Interpro: IPR039746  IPR034731  IPR036236  IPR013087  
  • Prosite: PS51810 PS00028 PS50157
  • STRING: ENSP00000384179
• Other Databases: GeneCards:  ZFPM2  Malacards:  ZFPM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0030154	cell differentiation	IBA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0007507	heart development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007506	gonadal mesoderm development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001570	vasculogenesis	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:2000020	positive regulation of male gonad development	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0030324	lung development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048568	embryonic organ development	IEA	biological process
GO:0048738	cardiac muscle tissue development	IEA	biological process
GO:2000195	negative regulation of female gonad development	IEA	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	ISS	biological process
GO:0008270	zinc ion binding	NAS	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003148	outflow tract septum morphogenesis	IMP	biological process
GO:0003221	right ventricular cardiac muscle tissue morphogenesis	IMP	biological process
GO:0060412	ventricular septum morphogenesis	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045599	negative regulation of fat cell differentiation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
46,XY gonadal dysgenesis	KEGG:H00607
Tetralogy of Fallot	KEGG:H00549
Congenital diaphragmatic hernia	KEGG:H01241
46,XY gonadal dysgenesis	KEGG:H00607
Tetralogy of Fallot	KEGG:H00549
Congenital diaphragmatic hernia	KEGG:H01241
Myelodysplastic syndrome	PMID:15705784
Tetralogy of Fallot	PMID:14517948
Hypospadias	MIK: 31219235
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31219235	Hypospadias	c.A2107C(p.M703L)	Chinese	134 cases	Male infertility	NGS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)