• Gene id: 23408

Gene Summary

• Gene Symbol: SIRT5   Gene   UCSC   Ensembl
• Aliases: SIR2L5
• Gene name: sirtuin 5
• Alternate names: NAD-dependent protein deacylase sirtuin-5, mitochondrial, NAD-dependent deacetylase sirtuin-5, NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial, silent mating type information regulation 2, S.cerevisiae, homolog 5, sir2-like 5, sirt,
• Gene location: 6p23 (131502970: 131462211)     Exons: 10     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det
• OMIM: 604483

Protein Summary

• Protein general information: Q9NXA8  
  • Name: NAD dependent protein deacylase sirtuin 5, mitochondrial (EC 2.3.1. ) (Regulatory protein SIR2 homolog 5) (SIR2 like protein 5)
  • Length: 310  
  • Mass: 33881
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGG
  YWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAG
  TKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGE
  NLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA
  LACHENETVS

• Structural information:
  • Protein Domains: (41..30-)
    (/note="Deacetylase-sirtuin-type)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03160"-)
  • Interpro: IPR029035  IPR003000  IPR026591  IPR027546  IPR026590  
  • Prosite: PS50305
  • CDD: cd01412
  • PDB: 2B4Y 2NYR 3RIG 3RIY 4F4U 4F56 4G1C 4HDA 5BWL 5XHS 6ACE 6ACL 6ACO 6ACP 6EQS
  • PDBsum: 2B4Y 2NYR 3RIG 3RIY 4F4U 4F56 4G1C 4HDA 5BWL 5XHS 6ACE 6ACL 6ACO 6ACP 6EQS
  • STRING: ENSP00000476228
• Other Databases: GeneCards:  SIRT5  Malacards:  SIRT5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061697	protein-glutaryllysine deglutarylase activity	IBA	molecular function
GO:0036054	protein-malonyllysine demalonylase activity	IBA	molecular function
GO:0036049	peptidyl-lysine desuccinylation	IBA	biological process
GO:0036047	peptidyl-lysine demalonylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0061698	protein deglutarylation	IBA	biological process
GO:0036055	protein-succinyllysine desuccinylase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0036054	protein-malonyllysine demalonylase activity	IDA	molecular function
GO:0061697	protein-glutaryllysine deglutarylase activity	IDA	molecular function
GO:0036054	protein-malonyllysine demalonylase activity	IDA	molecular function
GO:0036054	protein-malonyllysine demalonylase activity	IDA	molecular function
GO:0036049	peptidyl-lysine desuccinylation	IDA	biological process
GO:0036049	peptidyl-lysine desuccinylation	IDA	biological process
GO:0036047	peptidyl-lysine demalonylation	IDA	biological process
GO:0036047	peptidyl-lysine demalonylation	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0006476	protein deacetylation	IDA	NOT|biological process
GO:0006476	protein deacetylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0036048	protein desuccinylation	IDA	biological process
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0036046	protein demalonylation	IDA	biological process
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0036048	protein desuccinylation	IDA	biological process
GO:0061698	protein deglutarylation	IDA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0070403	NAD+ binding	IDA	molecular function
GO:0070403	NAD+ binding	IDA	molecular function
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0036055	protein-succinyllysine desuccinylase activity	IDA	molecular function
GO:0036048	protein desuccinylation	IDA	biological process
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0010566	regulation of ketone biosynthetic process	ISS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0036054	protein-malonyllysine demalonylase activity	IEA	molecular function
GO:0036055	protein-succinyllysine desuccinylase activity	IEA	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003950	NAD+ ADP-ribosyltransferase activity	TAS	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0007005	mitochondrion organization	TAS	biological process
GO:0034979	NAD-dependent protein deacetylase activity	TAS	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0010667	negative regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:1904229	regulation of succinate dehydrogenase activity	IEA	biological process
GO:0061697	protein-glutaryllysine deglutarylase activity	IEA	molecular function
GO:0036054	protein-malonyllysine demalonylase activity	IEA	molecular function
GO:0036049	peptidyl-lysine desuccinylation	IEA	biological process
GO:0036047	peptidyl-lysine demalonylation	IEA	biological process
GO:0010566	regulation of ketone biosynthetic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002931	response to ischemia	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0061698	protein deglutarylation	IEA	biological process
GO:0036055	protein-succinyllysine desuccinylase activity	IEA	molecular function
GO:0036048	protein desuccinylation	IEA	biological process
GO:0036046	protein demalonylation	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003950	NAD+ ADP-ribosyltransferase activity	TAS	NOT|molecular function
GO:0006471	protein ADP-ribosylation	TAS	NOT|biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006471	protein ADP-ribosylation	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0036054	protein-malonyllysine demalonylase activity	IEA	molecular function
GO:0036055	protein-succinyllysine desuccinylase activity	IEA	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0061699	peptidyl-lysine deglutarylation	IEA	biological process
GO:0061699	peptidyl-lysine deglutarylation	IEA	biological process
GO:0061699	peptidyl-lysine deglutarylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00760	Nicotinate and nicotinamide metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881