• Gene id: 23406

Gene Summary

• Gene Symbol: COTL1   Gene   UCSC   Ensembl
• Aliases: CLP
• Gene name: coactosin like F-actin binding protein 1
• Alternate names: coactosin-like protein, coactosin-like 1, epididymis secretory sperm binding protein,
• Gene location: 16q24.1 (186930525: 187078552)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has
• OMIM: 606748

Protein Summary

• Protein general information: Q14019  
  • Name: Coactosin like protein
  • Length: 142  
  • Mass: 15945
  • Tissue specificity: Widely expressed with highest levels in placenta, lung, kidney and peripheral blood leukocytes and lower levels in brain, liver and pancreas. {ECO
• Sequence:

  MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSK
  FALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE

• Structural information:
  • Protein Domains: (2..13-)
    (/note="ADF-H-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00599"-)
  • Interpro: IPR002108  IPR029006  IPR030502  
  • Prosite: PS51263
  • PDB: 1T2L 1T3X 1T3Y 1TMW 1VFQ 1WNJ
  • PDBsum: 1T2L 1T3X 1T3Y 1TMW 1VFQ 1WNJ
  • DIP: 30951
  • STRING: ENSP00000262428
• Other Databases: GeneCards:  COTL1  Malacards:  COTL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0030833	regulation of actin filament polymerization	IBA	biological process
GO:0030427	site of polarized growth	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005884	actin filament	IBA	colocalizes with
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0050832	defense response to fungus	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0008150	biological_process	ND	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq