• Gene id: 23405

Gene Summary

• Gene Symbol: DICER1   Gene   UCSC   Ensembl
• Aliases: DCR1, Dicer, Dicer1e, HERNA, K12H4.8-LIKE, MNG1, RMSE2
• Gene name: dicer 1, ribonuclease III
• Alternate names: endoribonuclease Dicer, Dicer1, Dcr-1 homolog, dicer 1, double-stranded RNA-specific endoribonuclease, dicer 1, ribonuclease type III, helicase MOI, helicase with RNAse motif,
• Gene location: 14q32.13 (95158262: 95086227)     Exons: 35     NC_000014.9
• Gene summary(Entrez): This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal R
• OMIM: 606241

SNPs

rs12323635

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000014.9   g.95159374C>T
NC_000014.8   g.95625711C>T
NG_016311.1   g.3049G>A|SEQ=[C/T]|GENE=DICER1
DICER1-AS1   400242

rs13078

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000014.9   g.95090410A>C
NC_000014.9   g.95090410A>T
NC_000014.8   g.95556747A>C
NC_000014.8   g.95556747A>T
NG_016311.1   g.72013T>G
NG_016311.1   g.72013T>A
NM_030621.4   c.*88T>G
NM_030621.4   c.*88T>A
NM_030621.3   c.*88T>G
NM_030621.3   c.*88T>A
NM_177438.3   c.*8

rs1057035

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000014.9   g.95087805T>C
NC_000014.8   g.95554142T>C
NG_016311.1   g.74618A>G
NM_030621.4   c.*2693A>G
NM_030621.3   c.*2693A>G
NM_177438.3   c.*2693A>G
NM_177438.2   c.*2693A>G
NM_001271282.3   c.*2693A>G
NM_001271282.2   c.*2693A>G
NM_001291628.1   c.*2693A>G
NM_00  

rs3742330

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000014.9   g.95087025A>G
NC_000014.8   g.95553362A>G
NG_016311.1   g.75398T>C
NM_030621.4   c.*3473T>C
NM_030621.3   c.*3473T>C
NM_177438.3   c.*3473T>C
NM_177438.2   c.*3473T>C
NM_001271282.3   c.*3473T>C
NM_001271282.2   c.*3473T>C
NM_001291628.1   c.*3473T>C
NM_00  

Protein Summary

• Protein general information: Q9UPY3  
  • Name: Endoribonuclease Dicer (EC 3.1.26.3) (Helicase with RNase motif) (Helicase MOI)
  • Length: 1922  
  • Mass: 218,682
• Sequence:

  MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAV
  LLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIM
  TCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQK
  LEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
  QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTP
  KVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVER
  RYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEG
  VDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD
  IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPL
  RASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYP
  KAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEV
  TISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI
  EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTK
  YNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRK
  AVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHS
  TIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN
  QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAVMPGTTDTIQVLKGRM
  DSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKK
  VSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEE
  SLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFED
  FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCG
  ERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMF
  DHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPR
  QHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE
  DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYD
  GKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS

• Structural information:
  • Protein Domains: Helicase (51-227)
    Helicase (433-602)
    Dicer (630-722)
    PAZ (891-1042)
  • Interpro: IPR038248  IPR005034  IPR014720  IPR006935  IPR014001   IPR001650  IPR027417  IPR003100  IPR036085  IPR000999  IPR036389  
  • Prosite: PS51327 PS50137 PS51192 PS51194 PS50821 PS00517 PS50142
  • CDD: cd00079 cd00593
  • PDB: 2EB1 4NGB 4NGC 4NGD 4NGF 4NGG 4NH3 4NH5 4NH6 4NHA 4WYQ
  • PDBsum: 2EB1 4NGB 4NGC 4NGD 4NGF 4NGG 4NH3 4NH5 4NH6 4NHA 4WYQ
  • DIP: 29664
  • STRING: ENSP00000343745
• Other Databases: GeneCards:  DICER1  Malacards:  DICER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IMP	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0004521	endoribonuclease activity	TAS	molecular function
GO:0004521	endoribonuclease activity	IDA	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	IDA	molecular function
GO:0004525	ribonuclease III activity	IDA	molecular function
GO:0004530	deoxyribonuclease I activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0010626	negative regulation of Schwann cell proliferation	ISS	biological process
GO:0014040	positive regulation of Schwann cell differentiation	ISS	biological process
GO:0014040	positive regulation of Schwann cell differentiation	ISS	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0021675	nerve development	ISS	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0031047	gene silencing by RNA	TAS	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0032290	peripheral nervous system myelin formation	ISS	biological process
GO:0033167	ARC complex	IC	cellular component
GO:0033168	conversion of ds siRNA to ss siRNA involved in RNA interference	IMP	biological process
GO:0035087	siRNA loading onto RISC involved in RNA interference	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	ISS	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0035197	siRNA binding	IDA	molecular function
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IDA	biological process
GO:0036404	conversion of ds siRNA to ss siRNA	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IMP	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0004521	endoribonuclease activity	TAS	molecular function
GO:0004521	endoribonuclease activity	IDA	molecular function
GO:0004525	ribonuclease III activity	IEA	molecular function
GO:0004525	ribonuclease III activity	IEA	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	IDA	molecular function
GO:0004525	ribonuclease III activity	IDA	molecular function
GO:0004530	deoxyribonuclease I activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0006396	RNA processing	IEA	biological process
GO:0010626	negative regulation of Schwann cell proliferation	ISS	biological process
GO:0014040	positive regulation of Schwann cell differentiation	ISS	biological process
GO:0014040	positive regulation of Schwann cell differentiation	ISS	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016891	endoribonuclease activity, producing 5'-phosphomonoesters	IEA	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0021675	nerve development	ISS	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0031047	gene silencing by RNA	TAS	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0032290	peripheral nervous system myelin formation	ISS	biological process
GO:0033167	ARC complex	IC	cellular component
GO:0033168	conversion of ds siRNA to ss siRNA involved in RNA interference	IMP	biological process
GO:0035087	siRNA loading onto RISC involved in RNA interference	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	ISS	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0035197	siRNA binding	IDA	molecular function
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IDA	biological process
GO:0036404	conversion of ds siRNA to ss siRNA	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IMP	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0004521	endoribonuclease activity	TAS	molecular function
GO:0004521	endoribonuclease activity	IDA	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	EXP	molecular function
GO:0004525	ribonuclease III activity	IDA	molecular function
GO:0004525	ribonuclease III activity	IDA	molecular function
GO:0004530	deoxyribonuclease I activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0010626	negative regulation of Schwann cell proliferation	ISS	biological process
GO:0014040	positive regulation of Schwann cell differentiation	ISS	biological process
GO:0014040	positive regulation of Schwann cell differentiation	ISS	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0021675	nerve development	ISS	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0031047	gene silencing by RNA	TAS	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0032290	peripheral nervous system myelin formation	ISS	biological process
GO:0033167	ARC complex	IC	cellular component
GO:0033168	conversion of ds siRNA to ss siRNA involved in RNA interference	IMP	biological process
GO:0035087	siRNA loading onto RISC involved in RNA interference	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	ISS	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0035197	siRNA binding	IDA	molecular function
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IDA	biological process
GO:0036404	conversion of ds siRNA to ss siRNA	IMP	biological process
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0070883	pre-miRNA binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Rhabdomyosarcoma	GAD: 606241
Cancer	GAD: 19138993
Cancer (esophageal)	GAD: 19138993
Cancer (head and neck)	GAD: 20819778
Cancer (lung)	GAD: 20721975
Cancer (oral premalignant lesions)	GAD: 19851984
Pleuropulmonary blastoma	OMIM: 606241
Cancer (Renal cell)	GAD: 19047128
Premature ovarian insufficiency (POI)	INFBASE: 23549446
Endometriosis	INFBASE: 21063030
Female infertility	INFBASE: 21063030
Male factor infertility	MIK: 22381205
Azoospermia	MIK: 27264823
Associated with sertoli cell function and survival	MIK: 19876815
Spermatogenic defects	MIK: 19876815
Azoospermia	MIK: 27264823
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 27695046
Progression of mammalian spermatogenesis	MIK: 25244517
Spermiogeneic defects, Male infertility	MIK: 21998645
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
27264823	Azoospermia	DICER rs3742330, DROSHA rs10719		612 (330 patients with primary azoospermia, 282 fertile male controls)	Male infertility	DICER DROSHA
22381205	Idiopathic male infertility,	DICER1 (rs13078, rs1057035 and rs12323635), DROSHA (rs10719, rs2291109, rs17409893 and rs642321)		1086 ( 667 infertile patients, 419 controls)	Male infertility
19876815	Associated with sertoli cell function, survival and spermatogenesis				Male infertility
27695046	Male infertility				Male infertility
29892896	Azoospermia	DICER1 (rs12323635, rs1057035, rs13078 and rs3742330), DROSHA (rs10719, rs642321 and rs2291102)	Iranian	505 (385 infertile men, 120 fertile controls)	Male infertility	DROSHA
25244517	Progression of mammalian spermatogenesis and male infertility				Male infertility
21998645	Spermiogeneic defects, Male ifnertility				Male infertility
21949761	Spermatid differentiation, Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq