• Gene id: 23404

Gene Summary

• Gene Symbol: EXOSC2   Gene   UCSC   Ensembl
• Aliases: RRP4, Rrp4p, SHRF, hRrp4p, p7
• Gene name: exosome component 2
• Alternate names: exosome complex component RRP4, exosome complex exonuclease RRP4, homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease (RRP4), homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease, ribosomal RNA-processing protein 4,
• Gene location: 9q34.12 (130693759: 130704893)     Exons: 9     NC_000009.12
• OMIM: 610528

Protein Summary

• Protein general information: Q13868  
  • Name: Exosome complex component RRP4 (Exosome component 2) (Ribosomal RNA processing protein 4)
  • Length: 293  
  • Mass: 32789
• Sequence:

  MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTR
  YIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFS
  DGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEP
  VSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

• Structural information:
  • Protein Domains: (79..15-)
    (/note="S1-motif")
  • Interpro: IPR025721  IPR026699  IPR004088  IPR036612  IPR012340  
  • PDB: 2NN6 6D6Q 6D6R 6H25
  • PDBsum: 2NN6 6D6Q 6D6R 6H25
  • DIP: 31264
  • STRING: ENSP00000361433
• Other Databases: GeneCards:  EXOSC2  Malacards:  EXOSC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0034427	nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'	IBA	biological process
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	IBA	biological process
GO:0071038	nuclear polyadenylation-dependent tRNA catabolic process	IBA	biological process
GO:0071049	nuclear retention of pre-mRNA with aberrant 3'-ends at the site of transcription	IBA	biological process
GO:0071051	polyadenylation-dependent snoRNA 3'-end processing	IBA	biological process
GO:0000176	nuclear exosome (RNase complex)	IBA	cellular component
GO:0000177	cytoplasmic exosome (RNase complex)	IBA	cellular component
GO:0000178	exosome (RNase complex)	IBA	cellular component
GO:0000467	exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0034475	U4 snRNA 3'-end processing	IBA	biological process
GO:0071034	CUT catabolic process	IBA	biological process
GO:0071035	nuclear polyadenylation-dependent rRNA catabolic process	IBA	biological process
GO:0004532	exoribonuclease activity	IDA	NOT|molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000176	nuclear exosome (RNase complex)	IDA	cellular component
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000178	exosome (RNase complex)	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000178	exosome (RNase complex)	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	TAS	molecular function
GO:0008312	7S RNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0000178	exosome (RNase complex)	IDA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0000178	exosome (RNase complex)	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881