• Gene id: 23401

Gene Summary

• Gene Symbol: FRAT2   Gene   UCSC   Ensembl
• Aliases: FRAT-2
• Gene name: FRAT regulator of WNT signaling pathway 2
• Alternate names: GSK-3-binding protein FRAT2, FRAT2, WNT signaling pathway regulator, frequently rearranged in advanced T-cell lymphomas 2,
• Gene location: 10q24.1 (97334728: 97332496)     Exons: 1     NC_000010.11
• Gene summary(Entrez): The protein encoded by this intronless gene belongs to the GSK-3-binding protein family. Studies show that this protein plays a role as a positive regulator of the WNT signaling pathway. It may be upregulated in tumor progression. [provided by RefSeq, Jul

Protein Summary

• Protein general information: O75474  
  • Name: GSK 3 binding protein FRAT2 (Frequently rearranged in advanced T cell lymphomas 2) (FRAT 2)
  • Length: 233  
  • Mass: 24051
• Sequence:

  MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPG
  PLAAAVPADKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLR
  DAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIA
  LQPSGSLL

• Structural information:
  • Interpro: IPR039202  IPR008014  
  • STRING: ENSP00000360058
• Other Databases: GeneCards:  FRAT2  Malacards:  FRAT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa04310	Wnt signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05224	Breast cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881