• Gene id: 23399

Gene Summary

• Gene Symbol: CTDNEP1   Gene   UCSC   Ensembl
• Aliases: DULLARD, HSA011916, NET56
• Gene name: CTD nuclear envelope phosphatase 1
• Alternate names: CTD nuclear envelope phosphatase 1, C-terminal domain nuclear envelope phosphatase 1, dullard homolog, serine/threonine-protein phosphatase dullard,
• Gene location: 17p13.1 (7251977: 7243590)     Exons: 9     NC_000017.11

Protein Summary

• Protein general information: O95476  
  • Name: CTD nuclear envelope phosphatase 1 (EC 3.1.3.16) (Serine/threonine protein phosphatase dullard)
  • Length: 244  
  • Mass: 28377
  • Tissue specificity: Muscle specific with lower expression in other metabolic tissues. {ECO
• Sequence:

  MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHS
  HHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRS
  ILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALR
  FTADVRSVLSRNLHQHRLW

• Structural information:
  • Protein Domains: (57..22-)
    (/note="FCP1-homology)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00336"-)
  • Interpro: IPR011948  IPR004274  IPR036412  IPR023214  
  • Prosite: PS50969
  • STRING: ENSP00000461749
• Other Databases: GeneCards:  CTDNEP1  Malacards:  CTDNEP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0034504	protein localization to nucleus	IDA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0071595	Nem1-Spo7 phosphatase complex	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010867	positive regulation of triglyceride biosynthetic process	IGI	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007498	mesoderm development	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0007276	gamete generation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0006998	nuclear envelope organization	IDA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881