• Gene id: 23394

Gene Summary

• Gene Symbol: ADNP   Gene   UCSC   Ensembl
• Aliases: ADNP1, HVDAS, MRD28
• Gene name: activity dependent neuroprotector homeobox
• Alternate names: activity-dependent neuroprotector homeobox protein, ADNP homeobox 1, activity-dependent neuroprotective protein, activity-dependent neuroprotector,
• Gene location: 20q13.13 (50931436: 50888917)     Exons: 9     NC_000020.11
• Gene summary(Entrez): Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be invol
• OMIM: 611386

Protein Summary

• Protein general information: Q9H2P0  
  • Name: Activity dependent neuroprotector homeobox protein (Activity dependent neuroprotective protein)
  • Length: 1102  
  • Mass: 123563
  • Tissue specificity: Widely expressed. Strong expression in heart, skeletal muscle, kidney and placenta. In brain, expression is stronger in the cerebellum and cortex regions. No expression detected in the colon. Strong increase of expression in colon and
• Sequence:

  MFQLPVNNLGSLRKARKTVKKILSDIGLEYCKEHIEDFKQFEPNDFYLKNTTWEDVGLWDPSLTKNQDYRTKPFC
  CSACPFSSKFFSAYKSHFRNVHSEDFENRILLNCPYCTFNADKKTLETHIKIFHAPNASAPSSSLSTFKDKNKND
  GLKPKQADSVEQAVYYCKKCTYRDPLYEIVRKHIYREHFQHVAAPYIAKAGEKSLNGAVPLGSNAREESSIHCKR
  CLFMPKSYEALVQHVIEDHERIGYQVTAMIGHTNVVVPRSKPLMLIAPKPQDKKSMGLPPRIGSLASGNVRSLPS
  QQMVNRLSIPKPNLNSTGVNMMSSVHLQQNNYGVKSVGQGYSVGQSMRLGLGGNAPVSIPQQSQSVKQLLPSGNG
  RSYGLGSEQRSQAPARYSLQSANASSLSSGQLKSPSLSQSQASRVLGQSSSKPAAAATGPPPGNTSSTQKWKICT
  ICNELFPENVYSVHFEKEHKAEKVPAVANYIMKIHNFTSKCLYCNRYLPTDTLLNHMLIHGLSCPYCRSTFNDVE
  KMAAHMRMVHIDEEMGPKTDSTLSFDLTLQQGSHTNIHLLVTTYNLRDAPAESVAYHAQNNPPVPPKPQPKVQEK
  ADIPVKSSPQAAVPYKKDVGKTLCPLCFSILKGPISDALAHHLRERHQVIQTVHPVEKKLTYKCIHCLGVYTSNM
  TASTITLHLVHCRGVGKTQNGQDKTNAPSRLNQSPSLAPVKRTYEQMEFPLLKKRKLDDDSDSPSFFEEKPEEPV
  VLALDPKGHEDDSYEARKSFLTKYFNKQPYPTRREIEKLAASLWLWKSDIASHFSNKRKKCVRDCEKYKPGVLLG
  FNMKELNKVKHEMDFDAEWLFENHDEKDSRVNASKTADKKLNLGKEDDSSSDSFENLEEESNESGSPFDPVFEVE
  PKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESG
  PGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNA
  SENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA

• Structural information:
  • Interpro: IPR038861  IPR009057  IPR001356  IPR013087  
  • Prosite: PS50071 PS00028 PS50157
  • CDD: cd00086
  • DIP: 47288
  • STRING: ENSP00000379346
• Other Databases: GeneCards:  ADNP  Malacards:  ADNP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0033484	nitric oxide homeostasis	IEA	biological process
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0031668	cellular response to extracellular stimulus	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0019934	cGMP-mediated signaling	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0007614	short-term memory	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005507	copper ion binding	IEA	molecular function
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0050805	negative regulation of synaptic transmission	IEA	biological process
GO:0048487	beta-tubulin binding	IEA	molecular function
GO:0044849	estrous cycle	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042277	peptide binding	IEA	molecular function
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0010835	regulation of protein ADP-ribosylation	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0010035	response to inorganic substance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Helsmoortel-van der Aa syndrome	KEGG:H02365
Helsmoortel-van der Aa syndrome	KEGG:H02365
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)