• Gene id: 23390

Gene Summary

• Gene Symbol: ZDHHC17   Gene   UCSC   Ensembl
• Aliases: DHHC-17, HIP14, HIP3, HSPC294, HYPH
• Gene name: zinc finger DHHC-type palmitoyltransferase 17
• Alternate names: palmitoyltransferase ZDHHC17, huntingtin interacting protein 14, huntingtin interacting protein 3, huntingtin yeast partner H, huntingtin-interacting protein H, putative MAPK-activating protein PM11, putative NF-kappa-B-activating protein 205, zinc finger DHHC d,
• Gene location: 12q21.2 (96709890: 96481625)     Exons: 16     NC_000007.14
• OMIM: 607799

Protein Summary

• Protein general information: Q8IUH5  
  • Name: Palmitoyltransferase ZDHHC17 (EC 2.3.1.225) (Huntingtin yeast partner H) (Huntingtin interacting protein 14) (HIP 14) (Huntingtin interacting protein 3) (HIP 3) (Huntingtin interacting protein H) (Putative MAPK activating protein PM11) (Putative NF kappa
  • Length: 632  
  • Mass: 72640
  • Tissue specificity: Expressed in all brain regions. Expression is highest in the cortex, cerebellum, occipital lobe and caudate and lowest in the spinal cord. Expression is also seen in testis, pancreas, heart and kidney. {ECO
• Sequence:

  MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRE
  LVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADP
  SLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHK
  NTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE
  FRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWF
  FWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPVRS
  KHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIA
  TCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF
  RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV

• Structural information:
  • Protein Domains: (437..48-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR001594  IPR030289  
  • Prosite: PS50297 PS50088 PS50216
  • PDB: 3EU9 5W7I 5W7J
  • PDBsum: 3EU9 5W7I 5W7J
  • STRING: ENSP00000403397
• Other Databases: GeneCards:  ZDHHC17  Malacards:  ZDHHC17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IBA	cellular component
GO:0018345	protein palmitoylation	IBA	biological process
GO:0016409	palmitoyltransferase activity	IBA	molecular function
GO:0015095	magnesium ion transmembrane transporter activity	IEA	molecular function
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0018345	protein palmitoylation	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0042953	lipoprotein transport	IDA	biological process
GO:0030660	Golgi-associated vesicle membrane	IDA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0000139	Golgi membrane	IDA	cellular component
GO:0018345	protein palmitoylation	IMP	biological process
GO:0016409	palmitoyltransferase activity	IMP	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)