• Gene id: 2339

Gene Summary

• Gene Symbol: FNTA   Gene   UCSC   Ensembl
• Aliases: FPTA, PGGT1A, PTAR2
• Gene name: farnesyltransferase, CAAX box, alpha
• Alternate names: protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, FTase-alpha, GGTase-I-alpha, farnesyl-protein transferase alpha-subunit, protein prenyltransferase alpha subunit repeat containing 2, ras proteins prenyltransferase subunit alpha, type ,
• Gene location: 8p11.21 (47963546: 47968877)     Exons: 9     NC_000012.12
• Gene summary(Entrez): Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share th
• OMIM: 134635

Protein Summary

• Protein general information: P49354  
  • Name: Protein farnesyltransferase/geranylgeranyltransferase type 1 subunit alpha (EC 2.5.1.58) (EC 2.5.1.59) (CAAX farnesyltransferase subunit alpha) (FTase alpha) (Ras proteins prenyltransferase subunit alpha) (Type I protein geranyl geranyltransferase subunit
  • Length: 379  
  • Mass: 44409
• Sequence:

  MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADI
  DPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHE
  EMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQ
  LLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
  DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPT
  NVQQ

• Structural information:
  • Interpro: IPR002088  
  • Prosite: PS51147
  • PDB: 1JCQ 1LD7 1LD8 1MZC 1S63 1SA4 1TN6 2F0Y 2H6F 2H6G 2H6H 2H6I 2IEJ 3E37
  • PDBsum: 1JCQ 1LD7 1LD8 1MZC 1S63 1SA4 1TN6 2F0Y 2H6F 2H6G 2H6H 2H6I 2IEJ 3E37
  • STRING: ENSP00000303423
• Other Databases: GeneCards:  FNTA  Malacards:  FNTA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004660	protein farnesyltransferase activity	IBA	contributes to
GO:0004662	CAAX-protein geranylgeranyltransferase activity	IBA	contributes to
GO:0005737	cytoplasm	IBA	cellular component
GO:0005953	CAAX-protein geranylgeranyltransferase complex	IBA	cellular component
GO:0005965	protein farnesyltransferase complex	IBA	cellular component
GO:0018344	protein geranylgeranylation	IBA	biological process
GO:0018343	protein farnesylation	IBA	biological process
GO:0018343	protein farnesylation	IDA	biological process
GO:0004661	protein geranylgeranyltransferase activity	IDA	molecular function
GO:0018344	protein geranylgeranylation	IDA	biological process
GO:0005965	protein farnesyltransferase complex	IDA	cellular component
GO:0005953	CAAX-protein geranylgeranyltransferase complex	IDA	cellular component
GO:0004660	protein farnesyltransferase activity	IDA	molecular function
GO:0018342	protein prenylation	IEA	biological process
GO:0008318	protein prenyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004659	prenyltransferase activity	IEA	molecular function
GO:0004660	protein farnesyltransferase activity	TAS	molecular function
GO:0004661	protein geranylgeranyltransferase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0018344	protein geranylgeranylation	TAS	biological process
GO:0018343	protein farnesylation	TAS	biological process
GO:0004660	protein farnesyltransferase activity	IEA	molecular function
GO:0004662	CAAX-protein geranylgeranyltransferase activity	IEA	molecular function
GO:0022400	regulation of rhodopsin mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071340	skeletal muscle acetylcholine-gated channel clustering	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0004663	Rab geranylgeranyltransferase activity	IEA	molecular function
GO:0004660	protein farnesyltransferase activity	IEA	molecular function
GO:0007528	neuromuscular junction development	IEA	biological process
GO:0045213	neurotransmitter receptor metabolic process	IEA	biological process
GO:0030548	acetylcholine receptor regulator activity	IEA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0004660	protein farnesyltransferase activity	IDA	contributes to
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0018343	protein farnesylation	IDA	biological process
GO:0090044	positive regulation of tubulin deacetylation	IDA	biological process
GO:0090045	positive regulation of deacetylase activity	IDA	biological process
GO:0005875	microtubule associated complex	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00900	Terpenoid backbone biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881