• Gene id: 23382

Gene Summary

• Gene Symbol: AHCYL2   Gene   UCSC   Ensembl
• Aliases: ADOHCYASE3, IRBIT2
• Gene name: adenosylhomocysteinase like 2
• Alternate names: adenosylhomocysteinase 3, IP(3)Rs binding protein released with IP(3) 2, S-adenosyl-L-homocysteine hydrolase 3, S-adenosylhomocysteine hydrolase-like 2, long-IRBIT, putative adenosylhomocysteinase 3,
• Gene location: 7q32.1 (129225029: 129430210)     Exons: 23     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene acts as a homotetramer and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding different isoforms have been found for this gene. [provided by
• OMIM: 609474

Protein Summary

• Protein general information: Q96HN2  
  • Name: Adenosylhomocysteinase 3 (AdoHcyase 3) (EC 3.3.1.1) (IP(3)Rs binding protein released with IP(3) 2) (IRBIT2) (Long IRBIT) (S adenosyl L homocysteine hydrolase 3) (S adenosylhomocysteine hydrolase like protein 2)
  • Length: 611  
  • Mass: 66721
• Sequence:

  MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSP
  AAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKIGRRSLSRSISQ
  SSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLA
  GAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE
  GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCR
  ESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDI
  VITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN
  LSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK
  NGPFKPNYYRY

• Structural information:
  • Interpro: IPR042172  IPR000043  IPR015878  IPR036291  IPR020082  
  • Prosite: PS00738 PS00739
  • CDD: cd00401
  • PDB: 3GVP
  • PDBsum: 3GVP
  • STRING: ENSP00000315931
• Other Databases: GeneCards:  AHCYL2  Malacards:  AHCYL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004013	adenosylhomocysteinase activity	IBA	NOT|molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0033353	S-adenosylmethionine cycle	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq