• Gene id: 23380

Gene Summary

• Gene Symbol: SRGAP2   Gene   UCSC   Ensembl
• Aliases: ARHGAP34, FNBP2, SRGAP2A, SRGAP3
• Gene name: SLIT-ROBO Rho GTPase activating protein 2
• Alternate names: SLIT-ROBO Rho GTPase-activating protein 2, SLIT-ROBO GAP2, formin-binding protein 2, rho GTPase-activating protein 34,
• Gene location: 1q32.1 (206203540: 206464435)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. The encoded protein stimulates GTPase activity of Rac1, and plays a role in cortical neuron development. This locus has several paralogs on human chromosome 1 resulting fro
• OMIM: 606524

Protein Summary

• Protein general information: O75044  
  • Name: SLIT ROBO Rho GTPase activating protein 2 (srGAP2) (Formin binding protein 2) (Rho GTPase activating protein 34)
  • Length: 1071  
  • Mass: 120871
• Sequence:

  MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFL
  AKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQ
  DDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSV
  KKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
  NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELVQRCQQLQS
  RLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRRANQQETEQFY
  FTKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLARRSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGI
  FRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALH
  IRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQH
  ENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFK
  KGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGH
  VADIYLANINKQRKRPESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
  LNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELRELERQSSVKHTPDVVLD
  TLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTN
  ATSPGVNSSTSPQSTDKSCTV

• Structural information:
  • Protein Domains: (22..32-)
    (/note="F-BAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01077-)
    (489..67-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172-)
    (728..78-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR027267  IPR031160  IPR001060  IPR008936  IPR000198   IPR036028  IPR001452  IPR035648  IPR030252  
  • Prosite: PS51741 PS50238 PS50002
  • CDD: cd11955
  • PDB: 2DL8 4RTT 4RUG 5I6J 5I6R 5I7D
  • PDBsum: 2DL8 4RTT 4RUG 5I6J 5I6R 5I7D
  • DIP: 37618
  • STRING: ENSP00000459615
• Other Databases: GeneCards:  SRGAP2  Malacards:  SRGAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0048365	Rac GTPase binding	IBA	molecular function
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:2001223	negative regulation of neuron migration	IDA	biological process
GO:0060996	dendritic spine development	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0051014	actin filament severing	IDA	biological process
GO:0048365	Rac GTPase binding	IDA	molecular function
GO:0048365	Rac GTPase binding	IDA	molecular function
GO:0046847	filopodium assembly	IDA	biological process
GO:0044327	dendritic spine head	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0030027	lamellipodium	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0060548	negative regulation of cell death	IMP	NOT|biological process
GO:0021816	extension of a leading process involved in cell motility in cerebral cortex radial glia guided migration	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0045335	phagocytic vesicle	ISS	cellular component
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0005096	GTPase activator activity	IMP	molecular function
GO:0014069	postsynaptic density	ISS	cellular component
GO:0003363	lamellipodium assembly involved in ameboidal cell migration	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R