• Gene id: 2335

Gene Summary

• Gene Symbol: FN1   Gene   UCSC   Ensembl
• Aliases: CIG, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF, SMDCF
• Gene name: fibronectin 1
• Alternate names: fibronectin, cold-insoluble globulin, migration-stimulating factor,
• Gene location: 2q35 (215436166: 215360439)     Exons: 46     NC_000002.12
• Gene summary(Entrez): This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature p
• OMIM: 135600

Protein Summary

• Protein general information: P02751  
  • Name: Fibronectin (FN) (Cold insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl Y1; Ugl Y2; Ugl Y3]
  • Length: 2386  
  • Mass: 262,625
• Sequence:

  MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALV
  CTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKI
  GDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITC
  TSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
  QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCT
  TEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQ
  NYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITY
  NVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
  PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGV
  VYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGF
  RVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDT
  SIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
  TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYF
  KVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSK
  YPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGG
  EAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
  PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRF
  TNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPL
  RGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYV
  VSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
  STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVT
  TTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
  AWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAP
  TDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
  SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQP
  GTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPR
  PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTH
  PGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP
  HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEAL
  KDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRW
  CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQ
  RGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

• Structural information:
  • Protein Domains: Fibronectin (50-90)
    Fibronectin (95-138)
    Fibronectin (139-182)
    Fibronect (184-228)
  • Interpro: IPR000083  IPR003961  IPR036116  IPR000562  IPR036943   IPR013783  IPR013806  
  • Prosite: PS00022 PS01253 PS51091 PS00023 PS51092 PS50853
  • CDD: cd00062 cd00063
  • PDB: 1E88 1E8B 1FBR 1FNA 1FNF 1FNH 1J8K 1O9A 1OWW 1Q38 1QGB 1QO6 1TTF 1TTG 2CG6 2CG7 2CK2 2CKU 2EC3 2FN2 2FNB 2GEE 2H41 2H45 2HA1 2MNU 2N1K 2OCF 2RKY 2RKZ 2RL0 3CAL 3EJH 3GXE 3M7P 3MQL 3R8Q 3T1W 3ZRZ 4GH7 4JE4 4JEG 4LXO 4MMX 4MMY 4MMZ 4PZ5 5DC0 5DC4 5DC9 5DFT
  • PDBsum: 1E88 1E8B 1FBR 1FNA 1FNF 1FNH 1J8K 1O9A 1OWW 1Q38 1QGB 1QO6 1TTF 1TTG 2CG6 2CG7 2CK2 2CKU 2EC3 2FN2 2FNB 2GEE 2H41 2H45 2HA1 2MNU 2N1K 2OCF 2RKY 2RKZ 2RL0 3CAL 3EJH 3GXE 3M7P 3MQL 3R8Q 3T1W 3ZRZ 4GH7 4JE4 4JEG 4LXO 4MMX 4MMY 4MMZ 4PZ5 5DC0 5DC4 5DC9 5DFT
  • DIP: 29547
• Other Databases: GeneCards:  FN1  Malacards:  FN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological process
GO:0001775	cell activation	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IDA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	NAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0005605	basal lamina	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0006953	acute-phase response	IEA	biological process
GO:0007044	cell-substrate junction assembly	IEA	biological process
GO:0007155	cell adhesion	NAS	biological process
GO:0007161	calcium-independent cell-matrix adhesion	IEA	biological process
GO:0008201	heparin binding	NAS	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008347	glial cell migration	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0009611	response to wounding	NAS	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016504	peptidase activator activity	IEA	molecular function
GO:0018149	peptide cross-linking	IDA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0033622	integrin activation	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEA	biological process
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0045340	mercury ion binding	IEA	molecular function
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0050921	positive regulation of chemotaxis	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071288	cellular response to mercury ion	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0071773	cellular response to BMP stimulus	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:1904237	positive regulation of substrate-dependent cell migration, cell attachment to substrate	IDA	biological process
GO:2001202	negative regulation of transforming growth factor-beta secretion	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0001775	cell activation	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IDA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	NAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005605	basal lamina	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0006953	acute-phase response	IEA	biological process
GO:0007044	cell-substrate junction assembly	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	NAS	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007161	calcium-independent cell-matrix adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008201	heparin binding	NAS	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008347	glial cell migration	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009611	response to wounding	NAS	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016504	peptidase activator activity	IEA	molecular function
GO:0018149	peptide cross-linking	IDA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0033622	integrin activation	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEA	biological process
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0045340	mercury ion binding	IEA	molecular function
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0050921	positive regulation of chemotaxis	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071288	cellular response to mercury ion	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0071773	cellular response to BMP stimulus	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:1904237	positive regulation of substrate-dependent cell migration, cell attachment to substrate	IDA	biological process
GO:2001202	negative regulation of transforming growth factor-beta secretion	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component
GO:0001932	regulation of protein phosphorylation	IDA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	NAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0008201	heparin binding	NAS	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009611	response to wounding	NAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0018149	peptide cross-linking	IDA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0033622	integrin activation	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:1904237	positive regulation of substrate-dependent cell migration, cell attachment to substrate	IDA	biological process
GO:2001202	negative regulation of transforming growth factor-beta secretion	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04512	ECM-receptor interaction
hsa04510	Focal adhesion
hsa04810	Regulation of actin cytoskeleton
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05222	Small cell lung cancer
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05135	Yersinia infection
hsa05100	Bacterial invasion of epithelial cells
hsa05165	Human papillomavirus infection
hsa05146	Amoebiasis

Diseases

Associated diseases	References
Cancer (lung)	GAD: 11605051
Cancer (ovarian)	GAD: 20628624
Cancer	GAD: 19730683
Cancer (thyroid)	GAD: 19730683
Cancer (breast)	GAD: 19094228
Cardiovascular disease	GAD: 16375583
Coronary heart disease	GAD: 16375583
Cryoglobulinemia	GAD: 17526550
Cleft defects	GAD: 20672350
Schizophrenia	GAD: 12497612
Endometriosis	INFBASE: 9022601
Female infertility	INFBASE: 24676469
Asthenozoospermia	MIK: 21848911
Asthenoteratozoospermia	MIK: 21848911
Oligoasthenoteratozoospermia	MIK: 21848911
Male factor infertility	MIK: 21848911
Semen coagulation, liquefaction and the survival and preparation of spermatozoa for fertility	MIK: 24358212
Leukocytospermia	MIK: 23920130
Male factor infertility	MIK: 23920130
Chorioamnionitis	GAD: 20452482
Chronic obstructive pulmonary disease (COPD)	GAD: 20463177
Systemic sclerosis	GAD: 9870923
Plasma fibronectin deficiency	OMIM: 135600
Glomerulopathy with fibronectin deposits	KEGG: H01260
Nephrolithiasis	GAD: 19616291
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 21848911
Asthenoteratozoospermia	MIK: 21848911
Oligoasthenoteratozoospermia	MIK: 21848911
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 7639343
Leucocytospermic seminal plasmas	MIK: 23920130
Male subfertility	MIK: 25248658
Semen coagulation, liquefaction and the survival and preparation of spermatozoa for fertility	MIK: 24358212
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24358212	Semen coagulation, liquefaction and the survival and preparation of spermatozoa for fertility				Male infertility	Eppin Fn
23920130	Male infertility, leucocytospermic seminal plasmas				Male infertility
7639343	Male infertility			142 (40 fertile, 102 infertile men)	Male infertility
25248658	Male subfertility			126 (67 normozoospermia, 14 oligozoospermia, 25 asthenozoospermia, 20 oligoasthenozoospermia)	Male infertility	Fibronectin ?1 -acid glycoprotein ?1 -antitrypsin immunoglobulin G and antithrombin III
21848911	Asthenozoospermia, asthenoteratozoospermia, oligoasthenoteratozoospermia, controls			110 (90 infertile males (27 asthenozoospermia, 30 asthenoteratozoospermia, 33 oligoasthenoteratozoospermia), 20 healthy fertile controls)	Male infertility	fibronectin
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray