• Gene id: 23332

Gene Summary

• Gene Symbol: CLASP1   Gene   UCSC   Ensembl
• Aliases: MAST1
• Gene name: cytoplasmic linker associated protein 1
• Alternate names: CLIP-associating protein 1, multiple asters 1, multiple asters homolog 1, protein Orbit homolog 1,
• Gene location: 2q14.2-q14.3 (121649461: 121337775)     Exons: 50     NC_000002.12
• Gene summary(Entrez): CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [Pub
• OMIM: 611133

Protein Summary

• Protein general information: Q7Z460  
  • Name: CLIP associating protein 1 (Cytoplasmic linker associated protein 1) (Multiple asters homolog 1) (Protein Orbit homolog 1) (hOrbit1)
  • Length: 1538  
  • Mass: 169451
• Sequence:

  MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVNSSNYKVVLLGMDILS
  ALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMDQAANPQYVWDRMLGGFKHKNFRTREGICLC
  LIATLNASGAQTLTLSKIVPHICNLLGDPNSQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDE
  VQKSGNMIQSANDKNFDDEDSVDGNRPSSASSTSSKAPPSSRRNVGMGTTRRLGSSTLGSKSSAAKEGAGAVDEE
  DFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKL
  SAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVIT
  SNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLY
  HTLESSYQKALQSHLKNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRS
  DIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLGRIRTRRQSSGSATNVASTPDNRGRSRAKVVSQSQRSR
  SANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLARSSRIPRPSMSQ
  GCSRDTSRESSRDTSPARGFPPLDRFGLGQPGRIPGSVNAMRVLSTSTDLEAAVADALKKPVRRRYEPYGMYSDD
  DANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEI
  FTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQ
  FNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISL
  FELNTPEFTMLLGALPKTFQDGATKLLHNHLKNSSNTSVGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPS
  RLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDL
  NEPIKRDGKKECDIVSRDGGAASPATEGRGGSEVEGGRTALDNKTSLLNTQPPRAFPGPRARDYNPYPYSDAINT
  YDKTALKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLL
  LLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIK
  VLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLK
  PHLAQLTGSKMKLLNLYIKRAQTTNSNSSSSSDVSTHS

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR028399  IPR024395  IPR021133   IPR034085  
  • Prosite: PS50077
  • PDB: 4K92 6MQ5 6MQ7
  • PDBsum: 4K92 6MQ5 6MQ7
  • STRING: ENSP00000263710
• Other Databases: GeneCards:  CLASP1  Malacards:  CLASP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0045180	basal cortex	IBA	cellular component
GO:0043515	kinetochore binding	IBA	molecular function
GO:0040001	establishment of mitotic spindle localization	IBA	biological process
GO:0031110	regulation of microtubule polymerization or depolymerization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0000776	kinetochore	IBA	cellular component
GO:0072686	mitotic spindle	IBA	cellular component
GO:0005881	cytoplasmic microtubule	IBA	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0034453	microtubule anchoring	IMP	biological process
GO:0007020	microtubule nucleation	IMP	biological process
GO:0007052	mitotic spindle organization	IMP	biological process
GO:0031023	microtubule organizing center organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005828	kinetochore microtubule	IEA	cellular component
GO:0043515	kinetochore binding	IEA	molecular function
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0051010	microtubule plus-end binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0051301	cell division	IDA	biological process
GO:0051294	establishment of spindle orientation	IDA	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0051294	establishment of spindle orientation	IGI	biological process
GO:0051294	establishment of spindle orientation	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005925	focal adhesion	IDA	colocalizes with
GO:0045180	basal cortex	IDA	cellular component
GO:0031592	centrosomal corona	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0051010	microtubule plus-end binding	IDA	molecular function
GO:0030981	cortical microtubule cytoskeleton	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0035371	microtubule plus-end	ISS	cellular component
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0030953	astral microtubule organization	IMP	biological process
GO:0090307	mitotic spindle assembly	ISS	biological process
GO:0034453	microtubule anchoring	IMP	biological process
GO:0040001	establishment of mitotic spindle localization	IMP	biological process
GO:0090162	establishment of epithelial cell polarity	ISS	biological process
GO:1904261	positive regulation of basement membrane assembly involved in embryonic body morphogenesis	IGI	biological process
GO:1904261	positive regulation of basement membrane assembly involved in embryonic body morphogenesis	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0010470	regulation of gastrulation	IMP	biological process
GO:0002162	dystroglycan binding	IPI	molecular function
GO:0070507	regulation of microtubule cytoskeleton organization	IGI	biological process
GO:0031116	positive regulation of microtubule polymerization	ISS	biological process
GO:0010717	regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0010458	exit from mitosis	IMP	biological process
GO:0007163	establishment or maintenance of cell polarity	NAS	biological process
GO:0007026	negative regulation of microtubule depolymerization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001578	microtubule bundle formation	IMP	biological process
GO:0051497	negative regulation of stress fiber assembly	IMP	biological process
GO:0051893	regulation of focal adhesion assembly	IMP	biological process
GO:0043515	kinetochore binding	IMP	molecular function
GO:0008017	microtubule binding	IMP	molecular function
GO:0005828	kinetochore microtubule	TAS	cellular component
GO:0006903	vesicle targeting	IMP	biological process
GO:0090091	positive regulation of extracellular matrix disassembly	IMP	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0031111	negative regulation of microtubule polymerization or depolymerization	IMP	biological process
GO:0007026	negative regulation of microtubule depolymerization	IGI	biological process
GO:0000226	microtubule cytoskeleton organization	IGI	biological process
GO:0045921	positive regulation of exocytosis	IMP	biological process
GO:1903690	negative regulation of wound healing, spreading of epidermal cells	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq