• Gene id: 23326

Gene Summary

• Gene Symbol: USP22   Gene   UCSC   Ensembl
• Aliases: USP3L
• Gene name: ubiquitin specific peptidase 22
• Alternate names: ubiquitin carboxyl-terminal hydrolase 22, deubiquitinating enzyme 22, ubiquitin specific protease 22, ubiquitin thioesterase 22, ubiquitin thiolesterase 22, ubiquitin-specific processing protease 22,
• Gene location: 17p11.2 (156826286: 157047658)     Exons: 19     NC_000003.12
• OMIM: 612116

Protein Summary

• Protein general information: Q9UPT9  
  • Name: Ubiquitin carboxyl terminal hydrolase 22 (EC 3.4.19.12) (Deubiquitinating enzyme 22) (Ubiquitin thioesterase 22) (Ubiquitin specific processing protease 22)
  • Length: 525  
  • Mass: 59961
  • Tissue specificity: Moderately expressed in various tissues including heart and skeletal muscle, and weakly expressed in lung and liver. {ECO
• Sequence:

  MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCICHVCGVHLNRLHS
  CLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEP
  TKRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMS
  SLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
  FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGNVVNGESHVSGTTTLTDCLRRFTRPEHL
  GSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQY
  QQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE

• Structural information:
  • Protein Domains: (176..52-)
    (/note="USP"-)
  • Interpro: IPR038765  IPR001394  IPR018200  IPR028889  IPR013083   IPR001607  
  • Prosite: PS00972 PS00973 PS50235 PS50271
  • STRING: ENSP00000261497
• Other Databases: GeneCards:  USP22  Malacards:  USP22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016574	histone ubiquitination	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000124	SAGA complex	IDA	cellular component
GO:0000124	SAGA complex	IDA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0070461	SAGA-type complex	IDA	colocalizes with
GO:0005634	nucleus	IEA	cellular component
GO:0043967	histone H4 acetylation	IEA	biological process
GO:0016578	histone deubiquitination	IDA	biological process
GO:0016578	histone deubiquitination	IDA	biological process
GO:0010485	H4 histone acetyltransferase activity	IDA	contributes to
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	contributes to
GO:0019899	enzyme binding	IPI	molecular function
GO:0009792	embryo development ending in birth or egg hatching	NAS	biological process
GO:0000124	SAGA complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R