• Gene id: 23318

Gene Summary

• Gene Symbol: TUT4   Gene   UCSC   Ensembl
• Aliases: PAPD3, TENT3A, ZCCHC11
• Gene name: terminal uridylyl transferase 4
• Alternate names: terminal uridylyltransferase 4, PAP associated domain containing 3, TUTase 4, zinc finger CCHC domain-containing protein 11, zinc finger CCHC-type containing 11, zinc finger, CCHC domain containing 11,
• Gene location: 1p32.3 (52553462: 52423274)     Exons: 35     NC_000001.11
• Gene summary(Entrez): ZCCHC11 is an RNA uridyltransferase (EC 2.7.7.52) that uses UTP to add uridines to the 3-prime end of substrate RNA molecules (Jones et al., 2009 [PubMed 19701194]).[supplied by OMIM, Jan 2011]
• OMIM: 300365

Protein Summary

• Protein general information: Q5TAX3  
  • Name: Terminal uridylyltransferase 4 (TUTase 4) (EC 2.7.7.52) (Zinc finger CCHC domain containing protein 11)
  • Length: 1644  
  • Mass: 185166
• Sequence:

  MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEVKSCKV
  NAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAKAEKSPKSPNSVKAEKASSYQMKS
  EKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDS
  DDSASGIEDVSDDLSKMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKRSPEYT
  NCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPAHLAALSVAVIELAKEHGITDDDLRV
  RQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFPPKMNHPDLLIKVLGILKKNVLYVDVESDFH
  AKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIEPVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALM
  VMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKK
  TETDNQSNAMKEKHGKSPLALETPNRVSLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIED
  PFSVKRNVARSLNSQLVYEYVVERFRAAYRYFACPQTKGGNKSTVDFKKREKGKISNKKPVKSNNMATNGCILLG
  ETTEKINAEREQPVQCDEMDCTSQRCIIDNNNLLVNELDFADHGQDSSSLSTSKSSEIEPKLDKKQDDLAPSETC
  LKKELSQCNCIDLSKSPDPDKSTGTDCRSNLETESSHQSVCTDTSATSCNCKATEDASDLNDDDNLPTQELYYVF
  DKFILTSGKPPTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPMTNRFREILDLVCKRCFDELSPPCSEQHNREQI
  LIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPI
  TTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYI
  LMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEF
  DFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAFINGRKLFGTPFYPLIGREAE
  YFFDSRVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKSLLFRLKKKDSEEEKEGNEEEKDSRDVLDPRDLHDTRD
  FRDPRDLRCFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRNLVNAQQVAGSAQQQGDQSIRTRQSSECSESPS
  YSPQPQPFPQNSSQSAAITQPSSQPGSQPKLGPPQQGAQPPHQVQMPLYNFPQSPPAQYSPMHNMGLLPMHPLQI
  PAPSWPIHGPVIHSAPGSAPSNIGLNDPSIIFAQPAARPVAIPNTSHDGHWPRTVAPNSLVNSGAVGNSEPGFRG
  LTPPIPWEHAPRPHFPLVPASWPYGLHQNFMHQGNARFQPNKPFYTQDRCATRRCRERCPHPPRGNVSE

• Structural information:
  • Protein Domains: (628..67-)
    (/note="PAP-associated-1)
    (1184..123-)
    (/note="PAP-associated-2")
  • Interpro: IPR002058  IPR002934  IPR001878  IPR036875  
  • Prosite: PS50158 PS00028
  • PDB: 6IW6
  • PDBsum: 6IW6
  • STRING: ENSP00000257177
• Other Databases: GeneCards:  TUT4  Malacards:  TUT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016779	nucleotidyltransferase activity	IBA	molecular function
GO:0071076	RNA 3' uridylation	IBA	biological process
GO:0050265	RNA uridylyltransferase activity	IBA	molecular function
GO:0031054	pre-miRNA processing	IBA	biological process
GO:0006397	mRNA processing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0031123	RNA 3'-end processing	IDA	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0010586	miRNA metabolic process	IDA	biological process
GO:0050265	RNA uridylyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0010526	negative regulation of transposition, RNA-mediated	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0050265	RNA uridylyltransferase activity	IDA	molecular function
GO:0010587	miRNA catabolic process	IMP	biological process
GO:0010586	miRNA metabolic process	ISS	biological process
GO:0001556	oocyte maturation	ISS	biological process
GO:0035198	miRNA binding	ISS	molecular function
GO:0031054	pre-miRNA processing	IMP	biological process
GO:0019827	stem cell population maintenance	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990074	polyuridylation-dependent mRNA catabolic process	ISS	biological process
GO:0071076	RNA 3' uridylation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0050265	RNA uridylyltransferase activity	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0071044	histone mRNA catabolic process	IMP	NOT|biological process

Diseases

Associated diseases	References
Breast cancer	PMID:21453498
liver benign neoplasm	PMID:24056962
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq