• Gene id: 23308

Gene Summary

• Gene Symbol: ICOSLG   Gene   UCSC   Ensembl
• Aliases: B7-H2, B7H2, B7RP-1, B7RP1, B7h, CD275, GL50, ICOS-L, ICOSL, LICOS
• Gene name: inducible T cell costimulator ligand
• Alternate names: ICOS ligand, B7 homolog 2, B7 homologue 2, B7-like protein Gl50, B7-related protein 1, transmembrane protein B7-H2 ICOS ligand,
• Gene location: 21q22.3 (44240942: 44216978)     Exons: 9     NC_000021.9

Protein Summary

• Protein general information: O75144  
  • Name: ICOS ligand (B7 homolog 2) (B7 H2) (B7 like protein Gl50) (B7 related protein 1) (B7RP 1) (CD antigen CD275)
  • Length: 302  
  • Mass: 33349
  • Tissue specificity: Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only i
• Sequence:

  MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLEN
  VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPS
  QDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQN
  LTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
  HV

• Structural information:
  • Protein Domains: (19..12-)
    (/note="Ig-like-V-type)
    (141..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000483732
• Other Databases: GeneCards:  ICOSLG  Malacards:  ICOSLG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050776	regulation of immune response	IBA	biological process
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0042113	B cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042110	T cell activation	NAS	biological process
GO:0042104	positive regulation of activated T cell proliferation	TAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0006972	hyperosmotic response	NAS	biological process
GO:0006952	defense response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq