• Gene id: 23299

Gene Summary

• Gene Symbol: BICD2   Gene   UCSC   Ensembl
• Aliases: SMALED2, SMALED2A, SMALED2B, bA526D8.1
• Gene name: BICD cargo adaptor 2
• Alternate names: protein bicaudal D homolog 2, bic-D 2, bicaudal D homolog 2, coiled-coil protein BICD2, cytoskeleton-like bicaudal D protein homolog 2, homolog of Drosophila bicaudal D,
• Gene location: 9q22.31 (92764840: 92711362)     Exons: 8     NC_000009.12
• Gene summary(Entrez): This gene is one of two human homologs of Drosophila bicaudal-D and a member of the Bicoid family. It has been implicated in dynein-mediated, minus end-directed motility along microtubules. It has also been reported to be a phosphorylation target of NIMA
• OMIM: 0

Protein Summary

• Protein general information: Q8TD16  
  • Name: Protein bicaudal D homolog 2 (Bic D 2)
  • Length: 824  
  • Mass: 93533
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEM
  EQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLASVAQELK
  EINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQ
  LEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALV
  NGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISEIQKLKQQLMQMEREKAGLLATLQDTQKQLEH
  TRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHEDGDYYEVDINGPEILACKYHVAVAEAGELR
  EQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKVSLLEKASRQDRELLARLEKELKKVSDVAGETQGSLSVAQD
  ELVTFSEELANLYHHVCMCNNETPNRVMLDYYREGQGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADG
  GTGDSSPSPGSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEE
  ILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMF
  ATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQTRRGRAKAAPKTKPATPSL

• Structural information:
  • Interpro: IPR018477  
  • PDB: 6OFP
  • PDBsum: 6OFP
  • DIP: 53426
  • STRING: ENSP00000349351
• Other Databases: GeneCards:  BICD2  Malacards:  BICD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IMP	cellular component
GO:0070507	regulation of microtubule cytoskeleton organization	IGI	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:0072393	microtubule anchoring at microtubule organizing center	IBA	biological process
GO:0034067	protein localization to Golgi apparatus	IBA	biological process
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0070840	dynein complex binding	IBA	molecular function
GO:0070507	regulation of microtubule cytoskeleton organization	IBA	biological process
GO:0051959	dynein light intermediate chain binding	IBA	molecular function
GO:0034452	dynactin binding	IBA	molecular function
GO:0033365	protein localization to organelle	IBA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0005643	nuclear pore	IDA	cellular component
GO:0005642	annulate lamellae	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070840	dynein complex binding	ISS	molecular function
GO:0034452	dynactin binding	ISS	molecular function
GO:0051642	centrosome localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	biological process
GO:0008093	cytoskeletal anchor activity	IEA	molecular function
GO:0070840	dynein complex binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0034067	protein localization to Golgi apparatus	IEA	biological process
GO:0072385	minus-end-directed organelle transport along microtubule	IEA	biological process
GO:0072393	microtubule anchoring at microtubule organizing center	IEA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA	biological process
GO:0034452	dynactin binding	IEA	molecular function
GO:0051959	dynein light intermediate chain binding	IEA	molecular function
GO:0070840	dynein complex binding	IEA	molecular function
GO:0017137	Rab GTPase binding	ISS	molecular function
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0072385	minus-end-directed organelle transport along microtubule	ISS	biological process
GO:0072393	microtubule anchoring at microtubule organizing center	ISS	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spinal muscular atrophy	KEGG:H00455
Spinal muscular atrophy	KEGG:H00455
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq