• Gene id: 23295

Gene Summary

• Gene Symbol: MGRN1   Gene   UCSC   Ensembl
• Aliases: RNF156
• Gene name: mahogunin ring finger 1
• Alternate names: E3 ubiquitin-protein ligase MGRN1, RING finger protein 156, RING-type E3 ubiquitin transferase MGRN1, mahogunin RING finger protein 1, mahogunin ring finger 1, E3 ubiquitin protein ligase, probable E3 ubiquitin-protein ligase MGRN1,
• Gene location: 16p13.3 (4624823: 4690973)     Exons: 17     NC_000016.10
• Gene summary(Entrez): Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004]
• OMIM: 607559

Protein Summary

• Protein general information: O60291  
  • Name: E3 ubiquitin protein ligase MGRN1 (EC 2.3.2.27) (Mahogunin RING finger protein 1) (RING finger protein 156) (RING type E3 ubiquitin transferase MGRN1)
  • Length: 552  
  • Mass: 60753
• Sequence:

  MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQFPYVTP
  APHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASEEFLNGRAVYS
  PKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFE
  KHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCT
  SCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSCPFKKSKPHPASLASKKPKR
  ETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKA
  PDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRESSSPESFITEEVDESSSPQQGTRAASIENVLQDSSP
  EHCGRGPPADIYLPALGPDSCSVGIDE

• Structural information:
  • Interpro: IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000262370
• Other Databases: GeneCards:  MGRN1  Malacards:  MGRN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008333	endosome to lysosome transport	IBA	biological process
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005769	early endosome	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IBA	biological process
GO:0045879	negative regulation of smoothened signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0045879	negative regulation of smoothened signaling pathway	IEA	biological process
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008333	endosome to lysosome transport	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0006513	protein monoubiquitination	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa04340	Hedgehog signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq