• Gene id: 23291

Gene Summary

• Gene Symbol: FBXW11   Gene   UCSC   Ensembl
• Aliases: BTRC2, BTRCP2, FBW1B, FBXW1B, Fbw11, Hos
• Gene name: F-box and WD repeat domain containing 11
• Alternate names: F-box/WD repeat-containing protein 11, F-box and WD repeats protein beta-TrCP2, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 1B, beta-transducin repeat-containing protein 2, homolog,
• Gene location: 5q35.1 (26158007: 26171348)     Exons: 3     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
• OMIM: 605651

Protein Summary

• Protein general information: Q9UKB1  
  • Name: F box/WD repeat containing protein 11 (F box and WD repeats protein beta TrCP2) (F box/WD repeat containing protein 1B) (Homologous to Slimb protein) (HOS)
  • Length: 542  
  • Mass: 62091
• Sequence:

  MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDL
  CIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELV
  CKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRC
  GRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
  TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKY
  IVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIR
  FDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPS
  AQNETRSPSRTYTYISR

• Structural information:
  • Protein Domains: (129..16-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR021977  IPR036047  IPR001810  IPR020472  IPR015943   IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS50181 PS00678 PS50082 PS50294
  • DIP: 27593
  • STRING: ENSP00000265094
• Other Databases: GeneCards:  FBXW11  Malacards:  FBXW11

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05170	Human immunodeficiency virus 1 infection
hsa04310	Wnt signaling pathway
hsa04120	Ubiquitin mediated proteolysis
hsa04390	Hippo signaling pathway
hsa04218	Cellular senescence
hsa04114	Oocyte meiosis
hsa04340	Hedgehog signaling pathway
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)