• Gene id: 2329

Gene Summary

• Gene Symbol: FMO4   Gene   UCSC   Ensembl
• Aliases: FMO2
• Gene name: flavin containing dimethylaniline monoxygenase 4
• Alternate names: dimethylaniline monooxygenase [N-oxide-forming] 4, FMO 4, dimethylaniline oxidase 4, flavin containing monooxygenase 4, hepatic flavin-containing monooxygenase 4,
• Gene location: 1q24.3 (171314130: 171342083)     Exons: 11     NC_000001.11
• Gene summary(Entrez): Metabolic N-oxidation of diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man. This results in a small subpopulation with reduced TMA N-oxidation capacity and causes

Protein Summary

• Protein general information: P31512  
  • Name: Dimethylaniline monooxygenase [N oxide forming] 4 (EC 1.14.13.8) (Dimethylaniline oxidase 4) (Hepatic flavin containing monooxygenase 4) (FMO 4)
  • Length: 558  
  • Mass: 63343
  • Tissue specificity: Liver.
• Sequence:

  MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVTNVCKEMSCYSDFPFH
  EDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFSETGQWDVVTETEGKQNRAVFDAVMVCTGHF
  LNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSS
  DWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT
  SVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKQVFPLNLERATLAIIGLIGLKG
  SILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLL
  FLKDPRLAWEVFFGPCTPYQYRLMGPGKWDGARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLA
  SLLLICKSSLFLKLVRDKLQDRMSPYLVSLWRG

• Structural information:
  • Interpro: IPR036188  IPR000960  IPR020946  IPR002256  
  • STRING: ENSP00000356723
• Other Databases: GeneCards:  FMO4  Malacards:  FMO4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0050661	NADP binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042737	drug catabolic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0004499	N,N-dimethylaniline monooxygenase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00982	Drug metabolism - cytochrome P450

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881