• Gene id: 2328

Gene Summary

• Gene Symbol: FMO3   Gene   UCSC   Ensembl
• Aliases: FMOII, TMAU, dJ127D3.1
• Gene name: flavin containing dimethylaniline monoxygenase 3
• Alternate names: dimethylaniline monooxygenase [N-oxide-forming] 3, FMO form 2, dimethylaniline oxidase 3, flavin containing monooxygenase 3, hepatic flavin-containing monooxygenase-3, trimethylamine monooxygenase,
• Gene location: 1q24.3 (171090872: 171117818)     Exons: 6     NC_000001.11
• Gene summary(Entrez): Flavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-,sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pes
• OMIM: 136132

Protein Summary

• Protein general information: P31513  
  • Name: Dimethylaniline monooxygenase [N oxide forming] 3 (EC 1.14.13.8) (EC 1.14.14.73) (Dimethylaniline oxidase 3) (FMO II) (FMO form 2) (Hepatic flavin containing monooxygenase 3) (FMO 3) (Trimethylamine monooxygenase) (EC 1.14.13.148)
  • Length: 532  
  • Mass: 60033
  • Tissue specificity: Liver.
• Sequence:

  MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFP
  DDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHH
  VYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVW
  DNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
  PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSL
  GAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWFGKSETIQTDYIVYMDELSSFIGAKPNIPWL
  FLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLI
  AVFLVLT

• Structural information:
  • Interpro: IPR036188  IPR000960  IPR020946  IPR002255  
  • STRING: ENSP00000356729
• Other Databases: GeneCards:  FMO3  Malacards:  FMO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0050661	NADP binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0034899	trimethylamine monooxygenase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00982	Drug metabolism - cytochrome P450

Diseases

Associated diseases	References
Trimethylaminuria	KEGG:H01234
Trimethylaminuria	KEGG:H01234
Hypertension	PMID:9536088
inherited metabolic disorder	PMID:9536088
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)