• Gene id: 23274

Gene Summary

• Gene Symbol: CLEC16A   Gene   UCSC   Ensembl
• Aliases: Gop-1, KIAA0350
• Gene name: C-type lectin domain containing 16A
• Alternate names: protein CLEC16A, C-type lectin domain family 16 member A,
• Gene location: 16p13.13 (10944487: 11193271)     Exons: 35     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the C-type lectin domain containing family. Single nucleotide polymorphisms in introns of this gene have been associated with diabetes mellitus, multiple sclerosis and rheumatoid arthritis. Multiple transcript variants encodi

Protein Summary

• Protein general information: Q2KHT3  
  • Name: Protein CLEC16A (C type lectin domain family 16 member A)
  • Length: 1053  
  • Mass: 117715
  • Tissue specificity: Almost exclusively expressed in immune cells, including dendritic cells, B-lymphocytes and natural killer cells. {ECO
• Sequence:

  MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIWGDQNDSSVFDFFLEK
  NMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFLKTLS
  LKLNNHTVHFFYNEHTNDFALYTEAIKFFNHPESMVRIAVRTITLNVYKVSLDNQAMLHYIRDKTAVPYFSNLVW
  FIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQD
  KGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTEQDIQRSSAKPSIRCFIKPTETLERS
  LEMNKHKGKRRVQKRPNYKNVGEEEDEEKGPTEDAQEDAEKAKGTEGGSKGIKTSGESEEIEMVIMERSKLSELA
  ASTSVQEQNTTDEEKSAAATCSESTQWSRPFLDMVYHALDSPDDDYHALFVLCLLYAMSHNKGMDPEKLERIQLP
  VPNAAEKTTYNHPLAERLIRIMNNAAQPDGKIRLATLELSCLLLKQQVLMSAGCIMKDVHLACLEGAREESVHLV
  RHFYKGEDIFLDMFEDEYRSMTMKPMNVEYLMMDASILLPPTGTPLTGIDFVKRLPCGDVEKTRRAIRVFFMLRS
  LSLQLRGEPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVK
  FAGLLQDMQVTGVEDDSRALNITIHKPASSPHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIAA
  LLDLPIQPTTEVLGFGLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSQS
  PPSASGSPSGSGSTSHCDSGGTSSSSTPSTAQSPADAPMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVE
  TASLSPSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPVGEEAACAEPVGT
  AED

• Structural information:
  • Protein Domains: (51..19-)
    (/note="FPL-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR039272  IPR019155  
  • STRING: ENSP00000387122
• Other Databases: GeneCards:  CLEC16A  Malacards:  CLEC16A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901096	regulation of autophagosome maturation	IBA	biological process
GO:0036020	endolysosome membrane	IBA	cellular component
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0008333	endosome to lysosome transport	IBA	biological process
GO:0016197	endosomal transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005770	late endosome	IBA	colocalizes with
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:1901525	negative regulation of mitophagy	IEA	biological process
GO:1901098	positive regulation of autophagosome maturation	IEA	biological process
GO:0036020	endolysosome membrane	IEA	cellular component
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0009267	cellular response to starvation	IMP	biological process
GO:1901097	negative regulation of autophagosome maturation	IMP	biological process
GO:1904263	positive regulation of TORC1 signaling	IMP	biological process
GO:1904766	negative regulation of macroautophagy by TORC1 signaling	IMP	biological process

Diseases

Associated diseases	References
Type 1 diabetes mellitus	KEGG:H00408
Type 1 diabetes mellitus	KEGG:H00408
Addison's disease	PMID:18593762
Multiple sclerosis	PMID:21653641
Rheumatoid arthritis	PMID:19221398
type 1 diabetes mellitus	PMID:18946483
type 1 diabetes mellitus	PMID:19221398
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq