• Gene id: 2326

Gene Summary

• Gene Symbol: FMO1   Gene   UCSC   Ensembl
• Gene name: flavin containing dimethylaniline monoxygenase 1
• Alternate names: dimethylaniline monooxygenase [N-oxide-forming] 1, FMO 1, Flavin-containing monooxygenase 1 (fetal liver), dimethylaniline oxidase 1, fetal hepatic flavin-containing monooxygenase 1, flavin containing monooxygenase 1,
• Gene location: 1q24.3 (171248470: 171285977)     Exons: 11     NC_000001.11
• Gene summary(Entrez): Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting
• OMIM: 610404

Protein Summary

• Protein general information: Q01740  
  • Name: Dimethylaniline monooxygenase [N oxide forming] 1 (EC 1.14.13.8) (Dimethylaniline oxidase 1) (Fetal hepatic flavin containing monooxygenase 1) (FMO 1)
  • Length: 532  
  • Mass: 60311
  • Tissue specificity: Expressed mainly in fetal and adult liver. {ECO
• Sequence:

  MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFP
  EDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFL
  TNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIF
  DSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
  PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPL
  GSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLF
  SMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLV
  AIFLIFL

• Structural information:
  • Interpro: IPR036188  IPR000960  IPR020946  IPR002253  
  • STRING: ENSP00000481732
• Other Databases: GeneCards:  FMO1  Malacards:  FMO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0050661	NADP binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0004497	monooxygenase activity	IDA	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0017144	drug metabolic process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0004499	N,N-dimethylaniline monooxygenase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0006970	response to osmotic stress	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0004499	N,N-dimethylaniline monooxygenase activity	IDA	molecular function
GO:0006082	organic acid metabolic process	IDA	biological process
GO:0070995	NADPH oxidation	IDA	biological process
GO:0009404	toxin metabolic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00982	Drug metabolism - cytochrome P450

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray