• Gene id: 2323

Gene Summary

• Gene Symbol: FLT3LG   Gene   UCSC   Ensembl
• Aliases: FL, FLG3L, FLT3L
• Gene name: fms related receptor tyrosine kinase 3 ligand
• Alternate names: fms-related tyrosine kinase 3 ligand, flt3 ligand, fms related tyrosine kinase 3 ligand,
• Gene location: 19q13.33 (49474171: 49487036)     Exons: 12     NC_000019.10
• Gene summary(Entrez): Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see
• OMIM: 602786

Protein Summary

• Protein general information: P49771  
  • Name: Fms related tyrosine kinase 3 ligand (Flt3 ligand) (Flt3L) (SL cytokine)
  • Length: 235  
  • Mass: 26416
• Sequence:

  MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWR
  LVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNF
  SRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVP
  SPQDLLLVEH

• Structural information:
  • Interpro: IPR009079  IPR004213  
  • PDB: 1ETE 3QS7 3QS9
  • PDBsum: 1ETE 3QS7 3QS9
  • DIP: 6220
  • STRING: ENSP00000469613
• Other Databases: GeneCards:  FLT3LG  Malacards:  FLT3LG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0009986	cell surface	IBA	cellular component
GO:0035162	embryonic hemopoiesis	IDA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032819	positive regulation of natural killer cell proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0030098	lymphocyte differentiation	IEA	biological process
GO:0045787	positive regulation of cell cycle	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0071864	positive regulation of cell proliferation in bone marrow	IEA	biological process
GO:0090290	positive regulation of osteoclast proliferation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0030885	regulation of myeloid dendritic cell activation	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0031233	intrinsic component of external side of plasma membrane	IEA	cellular component
GO:0032825	positive regulation of natural killer cell differentiation	IEA	biological process
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0071866	negative regulation of apoptotic process in bone marrow cell	IEA	biological process
GO:1901741	positive regulation of myoblast fusion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0016020	membrane	NAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
aplastic anemia	PMID:7492765
Fanconi anemia	PMID:7492765
Colon carcinoma	PMID:10842197
Glioblastoma multiforme	PMID:18079358
Malignant glioma	PMID:15564139
Myelofibrosis	PMID:21487043
multiple myeloma	PMID:26521986
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R