• Gene id: 23213

Gene Summary

• Gene Symbol: SULF1   Gene   UCSC   Ensembl
• Aliases: SULF-1
• Gene name: sulfatase 1
• Alternate names: extracellular sulfatase Sulf-1, sulfatase FP,
• Gene location: 8q13.2-q13.3 (69466623: 69660911)     Exons: 26     NC_000008.11
• Gene summary(Entrez): This gene encodes an extracellular heparan sulfate endosulfatase. The encoded enzyme selectively removes 6-O-sulfate groups from heparan sulfate chains of heparan sulfate proteoglycans (HSPGs). The enzyme is secreted through the Golgi and is subsequently
• OMIM: 616484

Protein Summary

• Protein general information: Q8IWU6  
  • Name: Extracellular sulfatase Sulf 1 (hSulf 1) (EC 3.1.6. )
  • Length: 871  
  • Mass: 101027
  • Tissue specificity: Expressed at highest levels in testis, stomach, skeletal muscle, lung, kidney, pancreas, small intestine and colon. It is also detected in normal ovarian surface epithelial cells. Down-regulation seen in ovarian carcinoma cell lines, o
• Sequence:

  MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSLQVMNKTRKIMEHGGA
  TFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAMHEPRTFAVYLNNTGYRTAFFGKYLNEYNGS
  YIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHGFDYAKDYFTDLITNESINYFKMSKRMYPHRPVMMVISHAAPH
  GPEDSAPQFSKLYPNASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNILQRKRLQTLMSVDDSVERLYNML
  VETGELENTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSVEPGSIVPQIVLNIDLAPTILDIAGLD
  TPPDVDGKSVLKLLDPEKPGNRFRTNKKAKIWRDTFLVERGKFLRKKEESSKNIQQSNHLPKYERVKELCQQARY
  QTACEQPGQKWQCIEDTSGKLRIHKCKGPSDLLTVRQSTRNLYARGFHDKDKECSCRESGYRASRSQRKSQRQFL
  RNQGTPKYKPRFVHTRQTRSLSVEFEGEIYDINLEEEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLA
  DSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQDKIKNLREVRGHLKRRKPEEC
  SCSKQSYYNKEKGVKKQEKLKSHLHPFKEAAQEVDSKLQLFKENNRRRKKERKEKRRQRKGEECSLPGLTCFTHD
  NNHWQTAPFWNLGSFCACTSSNNNTYWCLRTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQL
  HVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG

• Structural information:
  • Interpro: IPR017850  IPR014615  IPR024609  IPR024607  IPR000917  
  • Prosite: PS00523
  • STRING: ENSP00000260128
• Other Databases: GeneCards:  SULF1  Malacards:  SULF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005539	glycosaminoglycan binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IBA	molecular function
GO:0009986	cell surface	IBA	cellular component
GO:0010575	positive regulation of vascular endothelial growth factor production	IBA	biological process
GO:0032836	glomerular basement membrane development	IBA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030177	positive regulation of Wnt signaling pathway	IBA	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0048706	embryonic skeletal system development	IEA	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	IEA	biological process
GO:0003094	glomerular filtration	IEA	biological process
GO:0002063	chondrocyte development	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0060686	negative regulation of prostatic bud formation	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0035860	glial cell-derived neurotrophic factor receptor signaling pathway	IEA	biological process
GO:0032836	glomerular basement membrane development	IEA	biological process
GO:0014846	esophagus smooth muscle contraction	IEA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IEA	biological process
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0001822	kidney development	ISS	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0060348	bone development	ISS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005795	Golgi stack	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IDA	molecular function
GO:0004065	arylsulfatase activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IDA	molecular function
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	IDA	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	IDA	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0060686	negative regulation of prostatic bud formation	ISS	biological process
GO:0060384	innervation	ISS	biological process
GO:0035860	glial cell-derived neurotrophic factor receptor signaling pathway	ISS	biological process
GO:0014846	esophagus smooth muscle contraction	ISS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	ISS	biological process
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IMP	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0051216	cartilage development	ISS	biological process
GO:0048706	embryonic skeletal system development	ISS	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	NAS	biological process
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IMP	biological process
GO:0032836	glomerular basement membrane development	ISS	biological process
GO:0004065	arylsulfatase activity	IMP	molecular function
GO:0040036	regulation of fibroblast growth factor receptor signaling pathway	IMP	biological process
GO:0030513	positive regulation of BMP signaling pathway	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0003094	glomerular filtration	ISS	biological process
GO:0002063	chondrocyte development	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 22906644

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
22906644	Hypospadias	Methylation site (cg05355411)		20 (12 patients with isolated hypospadias and 8 healthy controls)	Male infertility	Microarray