• Gene id: 23212

Gene Summary

• Gene Symbol: RRS1   Gene   UCSC   Ensembl
• Gene name: ribosome biogenesis regulator 1 homolog
• Alternate names: ribosome biogenesis regulatory protein homolog, RRS1 ribosome biogenesis regulator homolog, homolog of yeast ribosome biogenesis regulator, homolog of yeast ribosome biogenesis regulatory protein RRS1, ribosome biogenesis regulator homolog, ribosome biogenesis,
• Gene location: 8q13.1 (66429013: 66430732)     Exons: 1     NC_000008.11
• OMIM: 607122

Protein Summary

• Protein general information: Q15050  
  • Name: Ribosome biogenesis regulatory protein homolog
  • Length: 365  
  • Mass: 41193
• Sequence:

  MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ
  LWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR
  DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQSKEELGRAMQVA
  KVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKPQLDVTRATNKQMREEDQEEA
  AKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLGGKRKGGQRPGGKRRK

• Structural information:
  • Interpro: IPR007023  
  • STRING: ENSP00000322396
• Other Databases: GeneCards:  RRS1  Malacards:  RRS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000055	ribosomal large subunit export from nucleus	IBA	biological process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0008097	5S rRNA binding	IDA	molecular function
GO:0042273	ribosomal large subunit biogenesis	IMP	biological process
GO:0000027	ribosomal large subunit assembly	IMP	biological process
GO:1902570	protein localization to nucleolus	IMP	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	IMP	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0000794	condensed nuclear chromosome	IDA	cellular component
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0000055	ribosomal large subunit export from nucleus	IBA	biological process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0008097	5S rRNA binding	IDA	molecular function
GO:0042273	ribosomal large subunit biogenesis	IMP	biological process
GO:0000027	ribosomal large subunit assembly	IMP	biological process
GO:1902570	protein localization to nucleolus	IMP	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	IMP	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0000794	condensed nuclear chromosome	IDA	cellular component
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881