• Gene id: 2321

Gene Summary

• Gene Symbol: FLT1   Gene   UCSC   Ensembl
• Aliases: FLT, FLT-1, VEGFR-1, VEGFR1
• Gene name: fms related tyrosine kinase 1
• Alternate names: vascular endothelial growth factor receptor 1, fms-like tyrosine kinase 1, fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor), tyrosine-protein kinase FRT, tyrosine-protein kinase receptor FLT, vascula,
• Gene location: 13q12.3 (28495127: 28300345)     Exons: 33     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a tra
• OMIM: 165070

Protein Summary

• Protein general information: P17948  
  • Name: Vascular endothelial growth factor receptor 1 (VEGFR 1) (EC 2.7.10.1) (Fms like tyrosine kinase 1) (FLT 1) (Tyrosine protein kinase FRT) (Tyrosine protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)
  • Length: 1338  
  • Mass: 150,769
• Sequence:

  MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLS
  ITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE
  GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
  TNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
  MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLP
  ATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ
  ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVA
  DSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
  HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAIS
  SSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQG
  TSDKSNLELITLTCTCVAATLFWLLLTLFIRKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARE
  RLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
  QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDK
  SLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN
  PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYS
  TPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
  PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTWTDSKPKASLKIDLRV
  TSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPPDYNSVVLYSTPPI

• Structural information:
  • Protein Domains: Ig-like (32-123)
    Ig-like (151-214)
    Ig-like (230-327)
    Ig-like (335-421)
    Ig-like (428-553)
    Ig-like (556-654)
    Ig-like (661-747)
    (827-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR013106  IPR013151  IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  IPR001824  IPR009135  
  • Prosite: PS50835 PS00107 PS50011 PS00109 PS00240
  • PDB: 1FLT 1QSV 1QSZ 1QTY 1RV6 2XAC 3HNG 4CKV 4CL7 5ABD 5EX3 5T89
  • PDBsum: 1FLT 1QSV 1QSZ 1QTY 1RV6 2XAC 3HNG 4CKV 4CL7 5ABD 5EX3 5T89
  • DIP: 643
  • STRING: ENSP00000282397
• Other Databases: GeneCards:  FLT1  Malacards:  FLT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IMP	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0010863	positive regulation of phospholipase C activity	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0036323	vascular endothelial growth factor receptor-1 signaling pathway	IDA	biological process
GO:0036326	VEGF-A-activated receptor activity	IDA	molecular function
GO:0036327	VEGF-B-activated receptor activity	IDA	molecular function
GO:0036332	placental growth factor-activated receptor activity	IDA	molecular function
GO:0038084	vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048514	blood vessel morphogenesis	ISS	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IEA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IEA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IMP	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0010863	positive regulation of phospholipase C activity	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016477	cell migration	IMP	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0019838	growth factor binding	IEA	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0036323	vascular endothelial growth factor receptor-1 signaling pathway	IDA	biological process
GO:0036326	VEGF-A-activated receptor activity	IDA	molecular function
GO:0036327	VEGF-B-activated receptor activity	IDA	molecular function
GO:0036332	placental growth factor-activated receptor activity	IDA	molecular function
GO:0038084	vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048514	blood vessel morphogenesis	ISS	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IMP	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0010863	positive regulation of phospholipase C activity	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0036323	vascular endothelial growth factor receptor-1 signaling pathway	IDA	biological process
GO:0036326	VEGF-A-activated receptor activity	IDA	molecular function
GO:0036327	VEGF-B-activated receptor activity	IDA	molecular function
GO:0036332	placental growth factor-activated receptor activity	IDA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048514	blood vessel morphogenesis	ISS	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04510	Focal adhesion
hsa05202	Transcriptional misregulation in cancer
hsa05323	Rheumatoid arthritis

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 20143086
Cancer (esophageal)	GAD: 20453000
Cancer (lymphoma)	GAD: 18636124
Cancer	GAD: 18636124
Hypertension	INFBASE: 23957293
Intrauterine growth retardation	GAD: 19658040
Sarcoidosis	GAD: 19741061
Bronchial hyperreactivity	GAD: 18315732
Hypercholesterolemia	GAD: 20602615
Bone diseases	GAD: 19453261
Cognitive function	GAD: 19734545
Chronic renal failure	GAD: 21085059
Preeclampsia	GAD: 18631405
Pregnancy loss	GAD: 18779584
Mullerian structure defects	INFBASE: 19200976
Endometriosis	INFBASE: 16179118
Endometriosis	INFBASE: 21733043
Polycystic ovary syndrome (PCOS)	INFBASE: 19330612
Preeclampsia	INFBASE: 24444293
Preeclampsia	INFBASE: 26116870
Female infertility	INFBASE: 19200976
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 16488907
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 11278207
Unexplained infertility	INFBASE: 18607827
Uterine anomalies	INFBASE: 19200976
Male factor infertility	MIK: 10438994
Chorioamnionitis	GAD: 20452482
Hydrosalpinx	INFBASE: 14585871
Spermiotelcosis	MIK: 19593986
Male infertility	MIK: 19593986
Varicocele	MIK: 19593986
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 10438994
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10438994	Male infertility			80 men whose spermatozoa were subsequently used for IVF or ICSI	Male infertility	Flt-1  KDR VEGF
19593986	Affect spermatogenesis and spermiotelcosis, which may be one of the causes of varicocele-induced male infertility or subfertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray