Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 23204
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol ARL6IP1   Gene   UCSC   Ensembl
Aliases AIP1, ARL6IP, ARMER, SPG61
Gene name ADP ribosylation factor like GTPase 6 interacting protein 1
Alternate names ADP-ribosylation factor-like protein 6-interacting protein 1, ADP-ribosylation factor GTPase 6 interacting protein 1, ADP-ribosylation factor-like 6 interacting protein 1, ARL-6-interacting protein 1, aip-1, apoptotic regulator in the membrane of the endoplasm,
Gene location 16p12.3 (18801548: 18791666)     Exons: 7     NC_000016.10
Gene summary(Entrez) This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane tr
OMIM 607669

Protein Summary
Protein general information Q15041  

Name: ADP ribosylation factor like protein 6 interacting protein 1 (ARL 6 interacting protein 1) (Aip 1) (Apoptotic regulator in the membrane of the endoplasmic reticulum)

Length: 203  Mass: 23363

Tissue specificity: Expressed in all hematopoietic cell lineages, but the highest level of expression is found in early myeloid progenitor cells. Expressed in brain, bone marrow, thymus and lung. Expressed at low level in liver, kidney and spleen. Not det

Sequence MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVM
FLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAW
VGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Structural information
Interpro:  IPR033301  
MINT:  
STRING:   ENSP00000306788
Other Databases GeneCards:  ARL6IP1  Malacards:  ARL6IP1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005789 endoplasmic reticulum mem
brane
 IDA cellular component
GO:1903371 regulation of endoplasmic
reticulum tubular networ
k organization
 IMP biological process
GO:0005784 Sec61 translocon complex
 IBA cellular component
GO:0016021 integral component of mem
brane
 IBA cellular component
GO:0006613 cotranslational protein t
argeting to membrane
 IBA biological process
GO:0043066 negative regulation of ap
optotic process
 IDA biological process
GO:0030176 integral component of end
oplasmic reticulum membra
ne
 IDA cellular component
GO:0071787 endoplasmic reticulum tub
ular network formation
 IDA biological process
GO:0005789 endoplasmic reticulum mem
brane
 IDA cellular component
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IDA biological process
GO:1990809 endoplasmic reticulum tub
ular network membrane org
anization
 IDA biological process
GO:0002038 positive regulation of L-
glutamate import across p
lasma membrane
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0006915 apoptotic process
 IEA biological process
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005784 Sec61 translocon complex
 IEA cellular component
GO:0005829 cytosol
 IEA cellular component
GO:0002038 positive regulation of L-
glutamate import across p
lasma membrane
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0006613 cotranslational protein t
argeting to membrane
 IEA biological process
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0012505 endomembrane system
 IEA cellular component
GO:0016020 membrane
 HDA cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Hereditary spastic paraplegia KEGG:H00266
Hereditary spastic paraplegia KEGG:H00266
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract