• Gene id: 23194

Gene Summary

• Gene Symbol: FBXL7   Gene   UCSC   Ensembl
• Aliases: FBL6, FBL7
• Gene name: F-box and leucine rich repeat protein 7
• Alternate names: F-box/LRR-repeat protein 7, F-box protein Fbl7,
• Gene location: 5p15.1 (15500179: 15939795)     Exons: 7     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiqu
• OMIM: 614362

Protein Summary

• Protein general information: Q9UJT9  
  • Name: F box/LRR repeat protein 7 (F box and leucine rich repeat protein 7) (F box protein FBL6/FBL7)
  • Length: 491  
  • Mass: 54575
• Sequence:

  MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGRGSST
  SSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
  PRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNI
  SNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
  THLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYC
  SKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVA
  ANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF

• Structural information:
  • Protein Domains: (111..15-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR001611  IPR006553  IPR032675  
  • Prosite: PS50181
  • STRING: ENSP00000423630
• Other Databases: GeneCards:  FBXL7  Malacards:  FBXL7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000278	mitotic cell cycle	ISS	biological process
GO:0005813	centrosome	ISS	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	ISS	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0019005	SCF ubiquitin ligase complex	ISS	cellular component
GO:0016567	protein ubiquitination	ISS	biological process
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0010265	SCF complex assembly	TAS	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IEA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000151	ubiquitin ligase complex	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq