• Gene id: 23192

Gene Summary

• Gene Symbol: ATG4B   Gene   UCSC   Ensembl
• Aliases: APG4B, AUTL1
• Gene name: autophagy related 4B cysteine peptidase
• Alternate names: cysteine protease ATG4B, APG4 autophagy 4 homolog B, ATG4 autophagy related 4 homolog B, AUT-like 1 cysteine endopeptidase, autophagin-1, autophagy-related cysteine endopeptidase 1, autophagy-related protein 4 homolog B, hAPG4B,
• Gene location: 2q37.3 (241637658: 241673856)     Exons: 16     NC_000002.12
• Gene summary(Entrez): Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, a
• OMIM: 611338

Protein Summary

• Protein general information: Q9Y4P1  
  • Name: Cysteine protease ATG4B (EC 3.4.22. ) (AUT like 1 cysteine endopeptidase) (Autophagin 1) (Autophagy related cysteine endopeptidase 1) (Autophagy related protein 4 homolog B) (hAPG4B)
  • Length: 393  
  • Mass: 44294
  • Tissue specificity: Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas. {ECO
• Sequence:

  MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCM
  LRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQ
  VLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLL
  IPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH
  CQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVE
  RLERFFDSEDEDFEILSL

• Structural information:
  • Interpro: IPR032916  IPR038765  IPR005078  
  • PDB: 2CY7 2D1I 2Z0D 2Z0E 2ZZP 5LXH 5LXI
  • PDBsum: 2CY7 2D1I 2Z0D 2Z0E 2ZZP 5LXH 5LXI
  • STRING: ENSP00000384259
• Other Databases: GeneCards:  ATG4B  Malacards:  ATG4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0051697	protein delipidation	IDA	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0006914	autophagy	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq