• Gene id: 23189

Gene Summary

• Gene Symbol: KANK1   Gene   UCSC   Ensembl
• Aliases: ANKRD15, CPSQ2, KANK
• Gene name: KN motif and ankyrin repeat domains 1
• Alternate names: KN motif and ankyrin repeat domain-containing protein 1, ankyrin repeat domain-containing protein 15, kidney ankyrin repeat-containing protein,
• Gene location: 9p24.3 (470290: 746105)     Exons: 28     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor fo
• OMIM: 607704

Protein Summary

• Protein general information: Q14678  
  • Name: KN motif and ankyrin repeat domain containing protein 1 (Ankyrin repeat domain containing protein 15) (Kidney ankyrin repeat containing protein)
  • Length: 1352  
  • Mass: 147,289
• Sequence:

  MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKRLNIQKRRKPSVPCPE
  PRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKH
  NLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSY
  APAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQ
  LVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQ
  ALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTE
  ADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQ
  MVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVC
  ETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTST
  DLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDR
  PSAVKTKESGVGQININDNYLVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDH
  YIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITG
  NYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLK
  SIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGH
  HAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRV
  SSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPI
  MLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCAS
  EHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGS
  FD

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR021939  
  • Prosite: PS50297 PS50088
  • CDD: cd00204
  • PDB: 5YBJ 5YBU
  • PDBsum: 5YBJ 5YBU
  • DIP: 56491
  • STRING: ENSP00000371734
• Other Databases: GeneCards:  KANK1  Malacards:  KANK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0035024	negative regulation of Rho protein signal transduction	IMP	biological process
GO:0035413	positive regulation of catenin import into nucleus	IMP	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IMP	biological process
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:1900028	negative regulation of ruffle assembly	IDA	biological process
GO:2000114	regulation of establishment of cell polarity	IMP	biological process
GO:2000393	negative regulation of lamellipodium morphogenesis	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0035024	negative regulation of Rho protein signal transduction	IMP	biological process
GO:0035413	positive regulation of catenin import into nucleus	IMP	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0046627	negative regulation of insulin receptor signaling pathway	IMP	biological process
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:1900028	negative regulation of ruffle assembly	IDA	biological process
GO:2000114	regulation of establishment of cell polarity	IMP	biological process
GO:2000393	negative regulation of lamellipodium morphogenesis	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0035024	negative regulation of Rho protein signal transduction	IMP	biological process
GO:0035413	positive regulation of catenin import into nucleus	IMP	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IMP	biological process
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:1900028	negative regulation of ruffle assembly	IDA	biological process
GO:2000114	regulation of establishment of cell polarity	IMP	biological process
GO:2000393	negative regulation of lamellipodium morphogenesis	IDA	biological process

Diseases

Associated diseases	References
Asthma	GAD: 22424883
Multiple sclerosis	GAD: 19506219
Cerebral palsy	KEGG: H01097
Disorders of sexual development (DSD)	MIK: 21048976
Disorders of sexual development (DSD)	MIK: 21048976
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21048976	Disorders of sexual development (DSD)			9067 (116 with idiopathic DSD, 8951 controls)	Male infertility	SRY DMRT1 FGFR2 KANK1 ADCY2 and ZEB2
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)