• Gene id: 23185

Gene Summary

• Gene Symbol: LARP4B   Gene   UCSC   Ensembl
• Aliases: KIAA0217, LARP5
• Gene name: La ribonucleoprotein 4B
• Alternate names: la-related protein 4B, La ribonucleoprotein domain family member 4B, La ribonucleoprotein domain family, member 5, la-related protein 5,
• Gene location: 10p15.3 (931899: 806913)     Exons: 23     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of an evolutionarily conserved protein family implicated in RNA metabolism and translation. Members of this family are characterized by the presence of an La motif, which is often located adjacent to one or more RNA recognition
• OMIM: 614276

Protein Summary

• Protein general information: Q92615  
  • Name: La related protein 4B (La ribonucleoprotein domain family member 4B) (La ribonucleoprotein domain family member 5) (La related protein 5)
  • Length: 738  
  • Mass: 80552
• Sequence:

  MTSDQDAKVVAEPQTQRVQEGKDSAHLMNGPISQTTSQTSSIPPLSQVPATKVSELNPNAEVWGAPVLHLEASSA
  ADGVSAAWEEVAGHHADRGPQGSDANGDGDQGHENAALPDPQESDPADMNALALGPSEYDSLPENSETGGNESQP
  DSQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLVQVDEK
  GEKVRPNQNRCIVILREISESTPVEEVEALFKGDNLPKFINCEFAYNDNWFITFETEADAQQAYKYLREEVKTFQ
  GKPIKARIKAKAIAINTFLPKNGFRPLDVSLYAQQRYATSFYFPPMYSPQQQFPLYSLITPQTWSATHSYLDPPL
  VTPFPNTGFINGFTSPAFKPAASPLTSLRQYPPRSRNPSKSHLRHAIPSAERGPGLLESPSIFNFTADRLINGVR
  SPQTRQAGQTRTRIQNPSAYAKREAGPGRVEPGSLESSPGLGRGRKNSFGYRKKREEKFTSSQTQSPTPPKPPSP
  SFELGLSSFPPLPGAAGNLKTEDLFENRLSSLIIGPSKERTLSADASVNTLPVVVSREPSVPASCAVSATYERSP
  SPAHLPDDPKVAEKQRETHSVDRLPSALTATACKSVQVNGAATELRKPSYAEICQRTSKEPPSSPLQPQKEQKPN
  TVGCGKEEKKLAEPAERYREPPALKSTPGAPRDQRRPAGGRPSPSAMGKRLSREQSTPPKSPQ

• Structural information:
  • Protein Domains: (150..23-)
    RNA-binding (/note="HTH-La-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00332-)
    (240..30-)
    (/note="RRM"-)
  • Interpro: IPR006630  IPR034900  IPR035979  IPR036388  IPR036390  
  • Prosite: PS50961
  • CDD: cd12706
  • PDB: 3PTH
  • PDBsum: 3PTH
  • STRING: ENSP00000482767
• Other Databases: GeneCards:  LARP4B  Malacards:  LARP4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042788	polysomal ribosome	IDA	cellular component
GO:0045727	positive regulation of translation	IMP	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray