• Gene id: 23184

Gene Summary

• Gene Symbol: MESD   Gene   UCSC   Ensembl
• Aliases: BOCA, MESDC2, OI20
• Gene name: mesoderm development LRP chaperone
• Alternate names: LRP chaperone MESD, LDLR chaperone MESD, mesoderm development LRP chaperone MESD, mesoderm development candidate 2, mesoderm development protein, renal carcinoma antigen NY-REN-61,
• Gene location: 15q25.1 (80989818: 80946288)     Exons: 4     NC_000015.10
• OMIM: 607783

Protein Summary

• Protein general information: Q14696  
  • Name: LRP chaperone MESD (LDLR chaperone MESD) (Mesoderm development LRP chaperone MESD) (Mesoderm development candidate 2) (Mesoderm development protein) (Renal carcinoma antigen NY REN 61)
  • Length: 234  
  • Mass: 26077
• Sequence:

  MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDD
  IEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRF
  IVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEEN
  RAGNKREDL

• Structural information:
  • Interpro: IPR019330  
  • STRING: ENSP00000261758
• Other Databases: GeneCards:  MESD  Malacards:  MESD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050750	low-density lipoprotein particle receptor binding	IBA	molecular function
GO:0006457	protein folding	ISS	biological process
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0006457	protein folding	IMP	biological process
GO:0006909	phagocytosis	ISS	biological process
GO:0001503	ossification	IMP	biological process
GO:1904395	positive regulation of skeletal muscle acetylcholine-gated channel clustering	ISS	biological process
GO:0034394	protein localization to cell surface	ISS	biological process
GO:0006457	protein folding	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0034394	protein localization to cell surface	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IEA	molecular function
GO:1904395	positive regulation of skeletal muscle acetylcholine-gated channel clustering	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007498	mesoderm development	NAS	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)