• Gene id: 23177

Gene Summary

• Gene Symbol: CEP68   Gene   UCSC   Ensembl
• Aliases: KIAA0582
• Gene name: centrosomal protein 68
• Alternate names: centrosomal protein of 68 kDa, centrosomal protein 68kDa,
• Gene location: 2p14 (65056401: 65087003)     Exons: 9     NC_000002.12

Protein Summary

• Protein general information: Q76N32  
  • Name: Centrosomal protein of 68 kDa (Cep68)
  • Length: 757  
  • Mass: 81102
• Sequence:

  MALGEEKAEAEASEDTKAQSYGRGSCRERELDIPGPMSGEQPPRLEAEGGLISPVWGAEGIPAPTCWIGTDPGGP
  SRAHQPQASDANREPVAERSEPALSGLPPATMGSGDLLLSGESQVEKTKLSSSEEFPQTLSLPRTTTICSGHDAD
  TEDDPSLADLPQALDLSQQPHSSGLSCLSQWKSVLSPGSAAQPSSCSISASSTGSSLQGHQERAEPRGGSLAKVS
  SSLEPVVPQEPSSVVGLGPRPQWSPQPVFSGGDASGLGRRRLSFQAEYWACVLPDSLPPSPDRHSPLWNPNKEYE
  DLLDYTYPLRPGPQLPKHLDSRVPADPVLQDSGVDLDSFSVSPASTLKSPTNVSPNCPPAEATALPFSGPREPSL
  KQWPSRVPQKQGGMGLASWSQLASTPRAPGSRDARWERREPALRGAKDRLTIGKHLDMGSPQLRTRDRGWPSPRP
  EREKRTSQSARRPTCTESRWKSEEEVESDDEYLALPARLTQVSSLVSYLGSISTLVTLPTGDIKGQSPLEVSDSD
  GPASFPSSSSQSQLPPGAALQGSGDPEGQNPCFLRSFVRAHDSAGEGSLGSSQALGVSSGLLKTRPSLPARLDRW
  PFSDPDVEGQLPRKGGEQGKESLVQCVKTFCCQLEELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDI
  DEHQSLTESVLQKGEILLQCLLENTPVLEDVLGRIAKQSGELESHADRLYDSILASLDMLAGCTLIPDKKPMAAM
  EHPCEGV

• Structural information:
  • DIP: 57845
  • STRING: ENSP00000367229
• Other Databases: GeneCards:  CEP68  Malacards:  CEP68

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010457	centriole-centriole cohesion	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0007098	centrosome cycle	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0010457	centriole-centriole cohesion	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0033365	protein localization to organelle	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray