• Gene id: 23171

Gene Summary

• Gene Symbol: GPD1L   Gene   UCSC   Ensembl
• Aliases: GPD1-L
• Gene name: glycerol-3-phosphate dehydrogenase 1 like
• Alternate names: glycerol-3-phosphate dehydrogenase 1-like protein,
• Gene location: 3p22.3 (32106619: 32168714)     Exons: 8     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene catalyzes the conversion of sn-glycerol 3-phosphate to glycerone phosphate. The encoded protein is found in the cytoplasm, associated with the plasma membrane, where it binds the sodium channel, voltage-gated, type V, alph
• OMIM: 611778

Protein Summary

• Protein general information: Q8N335  
  • Name: Glycerol 3 phosphate dehydrogenase 1 like protein (GPD1 L) (EC 1.1.1.8)
  • Length: 351  
  • Mass: 38419
  • Tissue specificity: Most highly expressed in heart tissue, with lower levels in the skeletal muscle, kidney, lung and other organs. {ECO
• Sequence:

  MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENV
  VAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIREKMGIDISVLM
  GANIANEVAAEKFCETTIGSKVMENGLLFKELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNT
  KAAVIRLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKEMLNGQKLQ
  GPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEHT

• Structural information:
  • Interpro: IPR008927  IPR013328  IPR006168  IPR006109  IPR017751   IPR011128  IPR036291  
  • PDB: 2PLA
  • PDBsum: 2PLA
  • STRING: ENSP00000282541
• Other Databases: GeneCards:  GPD1L  Malacards:  GPD1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006116	NADH oxidation	IBA	NOT|biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004367	glycerol-3-phosphate dehydrogenase [NAD+] activity	IBA	NOT|molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006072	glycerol-3-phosphate metabolic process	IEA	biological process
GO:0009331	glycerol-3-phosphate dehydrogenase complex	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0046168	glycerol-3-phosphate catabolic process	IEA	biological process
GO:0051287	NAD binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006734	NADH metabolic process	IEA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0017080	sodium channel regulator activity	IMP	molecular function
GO:0017080	sodium channel regulator activity	IMP	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0010765	positive regulation of sodium ion transport	IMP	biological process
GO:0010765	positive regulation of sodium ion transport	IMP	biological process
GO:0010765	positive regulation of sodium ion transport	IMP	biological process
GO:0019674	NAD metabolic process	IMP	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0060373	regulation of ventricular cardiac muscle cell membrane depolarization	IMP	biological process
GO:0060373	regulation of ventricular cardiac muscle cell membrane depolarization	IMP	biological process
GO:0086005	ventricular cardiac muscle cell action potential	IMP	biological process
GO:0086005	ventricular cardiac muscle cell action potential	IMP	biological process
GO:2000649	regulation of sodium ion transmembrane transporter activity	IMP	biological process
GO:2000649	regulation of sodium ion transmembrane transporter activity	IMP	biological process
GO:0002027	regulation of heart rate	IMP	biological process
GO:0002027	regulation of heart rate	IMP	biological process
GO:0090038	negative regulation of protein kinase C signaling	IMP	biological process
GO:2000010	positive regulation of protein localization to cell surface	IMP	biological process
GO:2000010	positive regulation of protein localization to cell surface	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism

Diseases

Associated diseases	References
Brugada syndrome	KEGG:H00728
Brugada syndrome	KEGG:H00728
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881